search for: p60

..., b5, b6 are the functions to be fitted. The remaining parameters are unknown and should follow from the fit. assuming that g(t) has the functional form: b4i + (b40-b4i)*exp(-k4*t) (after calculations of 2 papers of A4) follows the solution: L5L6 <- function(b40, b4i, k4, t, p50, p56, p60, p65, pc, ph, pd, pb50, pb60) { k50 <- exp(p50) k56 <- exp(p56) k60 <- exp(p60) k65 <- exp(p65) c <- exp(pc) h <- exp(ph) d <- exp(pd) b50 <- exp(pb50) b60 <- exp(pb60) a <- (k50+k56) b <- k65 e <- k56 f <- (k60+k65) z1 &lt...

...s <- length(x) p10 <- quantile(x,0.1,na.rm = TRUE, names = FALSE) p20 <- quantile(x,0.2,na.rm = TRUE, names = FALSE) p30 <- quantile(x,0.3,na.rm = TRUE, names = FALSE) p40 <- quantile(x,0.4,na.rm = TRUE, names = FALSE) p50 <- quantile(x,0.5,na.rm = TRUE, names = FALSE) p60 <- quantile(x,0.6,na.rm = TRUE, names = FALSE) p70 <- quantile(x,0.7,na.rm = TRUE, names = FALSE) p80 <- quantile(x,0.8,na.rm = TRUE, names = FALSE) p90 <- quantile(x,0.9,na.rm = TRUE, names = FALSE) Result <- data.frame(Samples,AMean,AStdev, Min,Max,p10,p20,p30,p40,p50,p60...

Hello, The 179th and 180th elements of my list of lists look like this: [[179]] [[179]]$desc [1] ">ipi|IPI00646510|IPI00646510.2 ISOFORM P60-HCK OF TYROSINE-PROTEIN KINASE HCK." [[179]]$seq [1] "MGGRSSCEDPGCPRDEERAPRMGCMKSKFLQVGGNTFSKTETSASPHCPVYVPDPTSTIKPGPNSHNSNTP GIREAGSEDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVDSLETEE WFFKGISRKDAERQLLAPGNMLGSFMIRDSETTKGSYSLSVRDYDPRQGDTVKHYKIRTLDNGGFYISPRST FSTLQELVDHYK...

...2 %r3 %r3 (0) 4: mov u32 %r2 %r3 (0) ... And after the first lowering step: MAIN:-1 () BB:0 (77 instructions) - df = { } -> BB:1 (tree) 0: mov u32 %r56 0x00000000 (0) 1: ld u64 %r57d c15[0x300] (0) 2: mov u32 %r58 0x00000004 (0) 3: ld u32 %r59 c15[0x308] (0) 4: set u8 %p60 gt u32 %r58 %r59 (0) 5: mov u32 %r61 0x00000000 (0) 6: not %p60 ld u32 %r62 g[%r57d+0x0] (0) ... Note how the 'b' printing is only used before the buffer access is lowered to a global access, so this seems to be the right thing todo. Regards, Hans > >> case FILE...

...p37=g(-1,2) p38=g(-1,3) p39=g(-1,4) p40=g(-1,5) p41=g(-0.5,-0.5) p42=g(-0.5,0) p43=g(-0.5,0.5) p44=g(-0.5,1) p45=g(-0.5,2) p46=g(-0.5,3) p47=g(-0.5,4) p48=g(-0.5,5) p49=g(0,-0.5) p50=g(0,0) p51=g(0,.5) p52=g(0,1) p53=g(0,2) p54=g(0,3) p55=g(0,4) p56=g(0,5) p57=g(0.5,-.5) p58=g(0.5,0) p59=g(0.5,.5) p60=g(0.5,1) p61=g(0.5,2) p62=g(0.5,3) p63=g(0.5,4) p64=g(0.5,5) p65=g(1,-.5) p66=g(1,0) p67=g(1,.5) p68=g(1,1) p69=g(1,2) p70=g(1,3) p71=g(1,4) p72=g(1,5) p73=g(2,-.5) p74=g(2,0) p75=g(2,.5) p76=g(2,1) p77=g(2,2) p78=g(2,3) p79=g(2,4) p80=g(2,5) p81=g(3,-.5) p82=g(3,0) p83=g(3,.5) p84=g(3,1) p85=g(3,2...

...p: >> >> MAIN:-1 () >> BB:0 (77 instructions) - df = { } >> -> BB:1 (tree) >> 0: mov u32 %r56 0x00000000 (0) >> 1: ld u64 %r57d c15[0x300] (0) >> 2: mov u32 %r58 0x00000004 (0) >> 3: ld u32 %r59 c15[0x308] (0) >> 4: set u8 %p60 gt u32 %r58 %r59 (0) >> 5: mov u32 %r61 0x00000000 (0) >> 6: not %p60 ld u32 %r62 g[%r57d+0x0] (0) >> ... >> >> Note how the 'b' printing is only used before the buffer access >> is lowered to a global access, so this seems to be the right thing...

...gt; And after the first lowering step: > > MAIN:-1 () > BB:0 (77 instructions) - df = { } > -> BB:1 (tree) > 0: mov u32 %r56 0x00000000 (0) > 1: ld u64 %r57d c15[0x300] (0) > 2: mov u32 %r58 0x00000004 (0) > 3: ld u32 %r59 c15[0x308] (0) > 4: set u8 %p60 gt u32 %r58 %r59 (0) > 5: mov u32 %r61 0x00000000 (0) > 6: not %p60 ld u32 %r62 g[%r57d+0x0] (0) > ... > > Note how the 'b' printing is only used before the buffer access > is lowered to a global access, so this seems to be the right thing todo. > Fine by me....

...() >>> BB:0 (77 instructions) - df = { } >>> -> BB:1 (tree) >>> 0: mov u32 %r56 0x00000000 (0) >>> 1: ld u64 %r57d c15[0x300] (0) >>> 2: mov u32 %r58 0x00000004 (0) >>> 3: ld u32 %r59 c15[0x308] (0) >>> 4: set u8 %p60 gt u32 %r58 %r59 (0) >>> 5: mov u32 %r61 0x00000000 (0) >>> 6: not %p60 ld u32 %r62 g[%r57d+0x0] (0) >>> ... >>> >>> Note how the 'b' printing is only used before the buffer access >>> is lowered to a global access, so this see...

I did a regression with ARMA errors using arima0 with ari<-arima0(y,order=c(2,0,2),xreg=reg1,delta=-1) or ari<-arima0(y,order=c(2,0,2),xreg=reg1) where reg1 is the matrix of the regressors and when I see diag(ari$var.coef) I get negative terms. Do you know what this mean ? I try to change transform.pars to 0 or 1 but this crash R on Windows. Is it possible to test the significativity

I've got a couple of SPARCstation 2s (about as fast as a fast 486, for most thing) that I'm going to be using for some testing. I realize that these machines are a bit slow, but when connecting via OpenSSH, it's MUCH slower than connecting to my 486-DX 50. The point where it waits is just after "debug: Sent encrypted session key.". The pause is for about 10 seconds, while

...nouveau 0000:03:00.0: fifo: engine 7: scheduled for recovery kernel: nouveau 0000:03:00.0: X[5295]: channel 2 killed! After this, I can only reboot using the reset button (hard lock up?) I'm using mesa 18.1.6, xf86-video-nouveau from git,kernel 4.18.8, firmwares 2018-09-13, Dual Monitor (4K p60 + 1080i) gtx970, this is a gentoo distro. I can help debug if needed, just tell me where/what to investigate. Unfortunately, I do not have any xorg log since the crash block the system entirely Thanks regards -- You are receiving this mail because: You are the assignee for the bug. ------------...

...C, exploitation becomes trivial. For more information on exploiting calls to free() see the excellent Phrack article "Once upon a free()" [2]. WORK AROUND - ----------- As mentioned in http://www.openssh.com/txt/preauth.adv, and as demonstrated by noir in http://www.phrack.org/phrack/60/p60-0x06.txt, "you can prevent privilege escalation if you enable UsePrivilegeSeparation in sshd_config." Love, - -- Mickey Mouse Hacking Squadron -----BEGIN PGP SIGNATURE----- Version: Hush 2.2 (Java) Note: This signature can be verified at https://www.hushtools.com/verify wlkEARECABkFAj4...

Some of the lowering steps we currently do for FILE_MEMORY_GLOBAL only apply to buffers, making it impossible to use FILE_MEMORY_GLOBAL for OpenCL global buffers. This commits changes the buffer code to use FILE_MEMORY_BUFFER at the ir_from_tgsi and lowering steps, freeing use of FILE_MEMORY_GLOBAL for use with OpenCL global buffers. Note that after lowering buffer accesses use the

...an interactive process that will result in the appropriate RPMs being upgraded on your system. Note that you need to select the kernel explicitly on default configurations of up2date. 5. Bug IDs fixed (http://bugzilla.redhat.com/bugzilla for more info): 55067 - Installer kernel won't boot on P60: machine check exception 55097 - bad: xconfig fails, good: config & menuconfig works 54829 - new linux-2.4.9-6 kernel fails to xconfig 54851 - Incorrect change to parameters for kallsyms_address_to_symbol() 54868 - NFS sever file lock is broken in 2.4.9-6 55082 - acenic driver on Kernel 2.4.9-6...

Is it possible to program the multi-purpose keys on a GXP-2000 remotely via a TFTP configuration file? If so, what are the parameters to put in the configuration file? Thanks, Daniel

...th: <mdr@dotforge.ch> Delivered-To: samba@lists.samba.org Received: from marpa.dotforge.ch (unknown [212.147.102.34]) by lists.samba.org (Postfix) with ESMTP id 29C964F60 for <samba@lists.samba.org>; Thu, 6 Sep 2001 12:47:14 -0700 (PDT) Received: from gimli.riedmatten (lsne-dial-11-p60.vtx.ch [212.147.27.124]) by marpa.dotforge.ch (Postfix) with ESMTP id 61B3D88001; Thu, 6 Sep 2001 21:51:22 +0200 (CEST) Received: by gimli.riedmatten (Postfix, from userid 500) id 8656E1F709; Thu, 6 Sep 2001 21:51:16 +0200 (CEST) From: Marcel de Riedmatten <mdr@dotforge.ch> To: Jonath...

Hello list. I'm trying to rebuild the 2.6.9.67.0.20.EL kernel, but it fails even without modifications. How did I try it? Created a (non-root) build environment (not a mock ) Installed the kernel.scr.rpm and did a rpmbuild -ba --target=`uname -m` kernel-2.6.spec 2> prep-err.log | tee prep-out.log The build failed at the end: Processing files: kernel-xenU-devel-2.6.9-67.0.20.EL Checking

I am trying to install mpg321 on another box. But there is no default libao driver on that sysytem, it has a soundblaster card, supported by the kernel directly. Never used OSS or ALSA on that system, so I wonder is it possible to do without OSS or ALSA . The libao documentation does not talk about kernel drivers, so I wonder how to get it work. Any ideas? Arne