similar to: some help regarding combining columns from different files

Dear all, I have a data which is in text file and i would like to import the data to R. From the manual, i?ve found the read.table command function is the most appropriate but when i wrote the command an error had occur. It say ?Error in read.table"C:/Users/user/Documents/cfa-1.txt", header = T, sep = "\t",skip=10) :more columns than column names?. Please help me with this as

Hi all, I have thousands of strings like these ones: "1159_1; YP_177963; PPE FAMILY PROTEIN" "1100_13; SECRETED L-ALANINE DEHYDROGENASE ALD CAA15575" "1141_24; gi;2894249;emb;CAA17111.1; PROBABLE ISOCITRATE DEHYDROGENASE" and various others.. I'm interested to extract the code for the protein (in this example: YP_177963, CAA15575, CAA17111). I

Hello, I've just started R, and I'm getting a bit mad using it. I've managed to produce a barplot with the labels for the ytick marks placed horizontally (perpendicular to the y-axis) usiing par(las=1). The problem is that most of my labels are in part beyond the plotting area because they are rather long (e.g. "H. sapiens", "D. melanogaster" ...). What is the

Hi, I have the following data frame: > print(mydatframe) __DATAFRAME__ V1 V2 V3 1 1007_s_at DDR1 discoidin domain receptor tyrosine kinase 1 2 1053_at RFC2 replication factor C (activator 1) 2, 40kDa 3 117_at HSPA6 heat shock 70kDa protein 6 (HSP70B') __END__ Is there a way to create a hash with V2 as Key and V3 as its value? - Gundala Viswanath Jakarta - Indonesia

Hi, i have two files (file1.txt and file2.txt) which i would like to merge, based on certain criteria, i.e. it combines data based on matching geneID and exons. i have used the merge option, but it does not give me the desired outcome. merged.txt shows the result i would like. *File1. txt* ** AffyProbe ProbeType Flag GeneSymbol GeneID Exons Chrom Strand Affytart AffyEnd 1

Hi, I have the following data file to be parsed and captured as a data frame: __DATA__ #GDS_ID GENE_NAME GENE_DESCRIPTION GENE_FUNCTION 1007_s_at | DDR1 | discoidin domain receptor tyrosine kinase 1 | protein-coding 1053_at | RFC2 | replication factor C (activator 1) 2, 40kDa | protein-coding 117_at | HSPA6 | heat shock 70kDa protein 6 (HSP70B') | protein-coding __END__ In particular it is

Hi all, My name is Amy, I am a masters student in Bioinformatics at North Carolina State University. I am working on a project and I am trying to use the lumi R package for microarray data analysis. I have shown the sample code here and have questions about modifying the sample code for my own data. lumi package in R, example.lumi, the sample data has 8000 features and 4 samples I have

Hello, I've read in a data file as a frame and now I'd like the columns to be rows and the rows to be columns. What's the easiest way to do this in R? > class(d) [1] "data.frame" > rownames(d) [1] "98x101" "40x98" "30x40" "0x30" > colnames(d) [1] "H..sapiens" "C..elegans"

Good afternoon all - While making a steady progress in learning R after Matlab I encountered a problem which seems to require some extra help to move over. Basically I want to merge a data from biological statistical dataset with annotation data extracted from another dataset using an 'id' crossreference and write it to report file. The first part goes absolutely fine, I have merged both

Hi All, I wonder if there should be one character for quote= in read.table, i.e., > args(read.table) function (file, header = FALSE, sep = "", quote = "\"'", dec = ".", ... I have a file containing the following lines, 08248-GOTERM 3'-phosphoadenosine 5'-phosphosulfate biosynthetic process 08279-GOTERM 3'-phosphoadenosine

Hi Joshua, thanks for answer. In this particular test my extension is on a simple network. There is no NAT, just an asterisk running on a virtual machine on a 7- 64bit CentOs. I am simulating an environment to be able to use PJSIP on my client. And even in this small environment, my extension does not call. My problem with NAT was with SIP "one way audio" on a client. All of this

Hello, The 179th and 180th elements of my list of lists look like this: [[179]] [[179]]$desc [1] ">ipi|IPI00646510|IPI00646510.2 ISOFORM P60-HCK OF TYROSINE-PROTEIN KINASE HCK." [[179]]$seq [1] "MGGRSSCEDPGCPRDEERAPRMGCMKSKFLQVGGNTFSKTETSASPHCPVYVPDPTSTIKPGPNSHNSNTP GIREAGSEDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVDSLETEE

Hello R-help group, I have a question about merging lists. I have two lists: Genes list (hSgenes) name chr strand start end transStart transEnd symbol description feature ENSG00000223972 1 1 11874 14412 11874 14412 DEAD/H box polypeptide 11 like 1DEAD/H box polypeptide 11 like 3DEAD/H box polypeptide 11 like 9 ;;

Hello. I am having a lot of problems with SIP through NAT. So, I decided to adopt PJSIP. However, I am not able to make the extensions ring when receiving a call from the queue. I'm using telnet to include the extension and on the asterisk console, it even shows Called PJSIP/6001, but the extension doesn't ring. If I call from extension to extension, it works normally. telenet:

I deal with a huge amount of Biology data stored in different databases. The databases belongig to Bioconductor organization can be accessed through Bioconductor packages. Unluckily some useful data is stored in databases like, for instance, miRDB, miRecords, etc ... which offer just an interactive HTML interface. See for instance http://mirdb.org/cgi-bin/search.cgi,

R-users, I have the following piece of code which I am trying to run on a dataframe (aga2) with about a half million records.  While the code works, it is extremely slow.  I've read some of the help archives indicating that I should allocate space to the p1 and ags1 vectors, which I have done, but this doesn't seem to improve speed much.  Would anyone be able to provide me with advice on

Dear All, The function curve() draws the graph of functions from R to R. Is there some homologous function to curve() to draw functions from R^2 to R? Thanks in advance, Paul

Hi, i have two files (file1.txt and file2.txt) which i would like to merge, based on certain criteria, i.e. it combines data based on matching geneID and exons. i have used the merge option, but it does not give me the desired outcome. merged.txt shows the result i would like. *File1. txt* ** AffyProbe ProbeType Flag GeneSymbol GeneID Exons Chrom Strand Affytart AffyEnd 1

Hi all, My name is Amy, I am a masters student in Bioinformatics at North Carolina State University. I am working on a project and I am trying to use the lumi R package for microarray data analysis. I have shown the sample code here and have questions about modifying the sample code for my own data. lumi package in R, example.lumi, the sample data has 8000 features and 4 samples I have

Hi: I have clustered microarray gene expression data and trying to map between microarray probe, gene, pathway, gene ontology, and homology for a set of (affy) microarray probes. Is there any package in R which facilitates this? I am looking at bioconductor, but till now could not find a solution. A link to some worked example would be appreciated. Thanks and regards. John [[alternative HTML