Displaying 14 results from an estimated 14 matches for "myk".
Did you mean:
my
2013 Feb 07
0
Help R.matlab
...eval expression used followed by the error displayed in the
matlab command window.
Received cmd: 3
Will read MAT file:
"C:\Users\tvb\AppData\Local\Temp\RtmpqqP3O8\file129c25a537b7.mat"
Received cmd: 1
"eval" string: "
Tr = TrA(INF,:).* IHo;
Susc = SHo * Sc;
myKS = ones(N,1);
myKS(find(moveBan > 0),1) = KernelShrinkage;
myKS = gpuArray(myKS);
dMG = gpuArray(dM(:,INF));
K1G = exp(-kparShort*(dMG));
K1G = bsxfun(@times, myKS,K1G);
K2G = exp(-kparLong*(dMG));
K2G = bsxfun(@times, myKS,K2G);
FoIG=Susc.*((K1G*(Tr(:...
2012 Nov 06
1
virt-install kickstart local file
Hi Everybody:
I am trying to get virt-install to work with a kickstart file that is on
the local file system.
I tried using the --initrd-inject="/tmp"
--extra-args="ks=file:/myks.cfg" but I got this error message:
ERROR --extra-args only work if specified with --location.
Here is the basic command:
virt-install \
--accelerate \
--cdrom /tools/iso/CentOS-6.3-x86_64-bin-DVD1.iso \
--disk device=disk,path="/var/lib/libvirt/images/myguest.img"...
2008 Mar 19
14
dladm does not show create-etherstub option.
Hi All,
I have bfu''ed to net-virt_xb-21_snv_81_021308.
The dladm command on my machine does not have create-etherstub option.
Please let me know what could be the issue.
Thanks
Khushal
2009 Oct 26
1
Bootable USB key...
...linux
/syslinux/boot.cat
/syslinux/boot.msg
/syslinux/general.msg
/syslinux/initrd.img
/syslinux/memtest
/syslinux/options.msg
/syslinux/param.msg
/syslinux/rescue.msg
/syslinux/splash.lss
/syslinux/TRANS.TBL
/syslinux/vmlinuz
/syslinux/syslinux.cfg
Configuration:
default myks
timeout 60
...
label myks
kernel vmlinuz
append initrd=initrd.img ks=hd:sda2:/ks.cfg method=hd:sda2:/centos
...
And to be sure:
dd if=/usr/lib/syslinux/mbr.bin of=/dev/sdg
I remade it to upgrade the OS version (but still (isolinux 3.11-4) and it does not boot anymore...
I get to...
2013 Jul 17
1
i can figure out. is it config issue or bug. please help
...ith Samba
2.7 stable.
even groups who to not have "r-x" permission can not copy data.
same goes for eveyone with "r-x" no user can copy the data.
until i give them "rwx"
this wasn't happening previously.
is there anyone who can help me in this regard.
Thanks,
MYK
2013 Jul 17
1
tab key does not complete the package name or list the packages in apt-get command
...other debian machines when i type "apt-get install sam<tab>" it give
me all item start from sam and this is a default behavour. however now for
some reason <tab> key is not working. is there anyone know why.
note: for other commands <tab> key is working fine.
Thanks,
Myk
2009 Jun 07
1
Re: freebsd on opensolaris dom0
...the difference and the fact that you can''t reproduce the crash
on CentOS (must be 3.3 ?)
Third, there has been a heavy development in opensolaris on he virtual
network interface level (so call crossbow)
Four, it might also be related to the actual opensolaris driver (which
is 3rd party, myk for my Marvell yukon Gb), I could try to test if it''s
the same with another one
Four, i386 vs amd64
I think it might be useful to copy this thread to the xen mailing list
on opensolaris
Thanks
Bruno
_______________________________________________
freebsd-xen@freebsd.org mailing list
ht...
2013 Jul 26
1
variación en los resultados de k medias (Alfredo Alvarez)
Buen día, no sé si estoy utilizando bien la lista, es la primera vez. Si lo
hago mal me corrigen por favor.
Sobre tu comentario Pedro, muchas gracias. Lo qeu entiendo con tu
sugerencia de set.seed es qeu de esa forma fijas los resultados, pero no
estoy seguro si otra agrupación funcione mejor. Es decir me interesa un
método de agrupación que genere la "mejor" agrupación y como los
2003 Jun 09
1
estimate the number of clusters
...ex<-rep(0,maxk) # hold the si values for each k clusters
mdist<-1-cor(t(mydata)) #dissimlarity
mdist<-as.dist(mdist)
for(k in 2:maxk)
{
hc<-diana(mdist,diss =TRUE, stand = FALSE)
si<-silhouette.default(cutree(as.hclust(hc),k=k),mdist)
myindex<-summary(si)$avg.width
}
myk<-rev(order(myindex))[1] #select the number of k clusters with the
#largest si value
I met the following problems:
> for(k in 2:maxk)
+ {
+ hc<-diana(mdist,diss =TRUE, stand = FALSE)
+ si<-silhouette.default(cutree(as.hclust(hc...
2013 Jul 05
0
wbinfo -u showing two machine users including domain users.
...llation.
(then it list down everything correctly from domain)
is there anyone who can tell me from where both the users are coming.
and how can i fix this issue. i am actually playing with some scripts and
these wrong users (local user instead of domain) are hurdling my work
thanks in advance.
MYK
2014 Apr 04
1
need help on libvirt and virt manager
...;Virt-manager" GuI is running on the
back end. so that i can learn how it add,edit,delete some advance level of
configuration via GUI.
i mean like we have "history" command which show what have we run in past
so can i also have the details what Virt-manager has run remotely
Thanks,
MYK
2012 Jan 14
1
Error: unexpected '<' in "<" when modifying existing functions
Hi.
I am trying to modify kmeans function.
It seems that is failing something obvious with the workspace.
I am a newbie and here is my code:
myk = function (x, centers, iter.max = 10, nstart = 1, algorithm =
c("Hartigan-Wong",
+ "Lloyd", "Forgy", "MacQueen"))
+ {
+ do_one <- function(nmeth) {
+ Z <- switch(nmeth, {
+ Z <- .Fortran(R_kmns, as.double(x), as.integer(m...
2004 Feb 19
1
Process R segmentation with strsplit() (PR#6601)
..._RESPAGE=None&FORMAT_OBJECT=Alignment&FORMAT_TYPE=HTML&GAPCOSTS=11+1&I_THRESH=0.001&LAYOUT=TwoWindows&MATRIX_NAME=BLOSUM62&NCBI_GI=on&PAGE=Proteins&PROGRAM=blastp&QUERY=MVCDKCEKKLSKVIVPDKWKDGARNVTEGGGRKINENKLLSKKNRWSPYSTCTTKCMICKQQVHQDGKYCHTCAYSKGVCAMCGKQVLDTKMYKQSNV&SERVICE=plain&SET_DEFAULTS.x=9&SET_DEFAULTS.y=5&SHOW_OVERVIEW=on&WORD_SIZE=3&END_OF_HTTPGET=Yes\" TARGET=\"_blank\">At1g61780</A> against nr\nUnformatted <A HREF=\"../cgi/getseq.pl?GabiMips+At1g61780+seq\" TARGET=\"_blank\"&...
2006 Jul 20
1
samba as pdc in Ubuntu dapper, fails on ps$ join?
Hola,
I've done everything as correct as I can see in smb.conf under fresh ubuntu 6.06 fully
updated install to have it run as a PDC on hostname florentine, domain DAVEYST.
There are no testparm errors.
I've added users with useradd and smbpasswd -a
I've added machines with useradd and smbpasswd -a -m
I can see the server in my network neighbourhood and access/browse folders on