search for: myk

...eval expression used followed by the error displayed in the matlab command window. Received cmd: 3 Will read MAT file: "C:\Users\tvb\AppData\Local\Temp\RtmpqqP3O8\file129c25a537b7.mat" Received cmd: 1 "eval" string: " Tr = TrA(INF,:).* IHo; Susc = SHo * Sc; myKS = ones(N,1); myKS(find(moveBan > 0),1) = KernelShrinkage; myKS = gpuArray(myKS); dMG = gpuArray(dM(:,INF)); K1G = exp(-kparShort*(dMG)); K1G = bsxfun(@times, myKS,K1G); K2G = exp(-kparLong*(dMG)); K2G = bsxfun(@times, myKS,K2G); FoIG=Susc.*((K1G*(Tr(:...

Hi Everybody: I am trying to get virt-install to work with a kickstart file that is on the local file system. I tried using the --initrd-inject="/tmp" --extra-args="ks=file:/myks.cfg" but I got this error message: ERROR --extra-args only work if specified with --location. Here is the basic command: virt-install \ --accelerate \ --cdrom /tools/iso/CentOS-6.3-x86_64-bin-DVD1.iso \ --disk device=disk,path="/var/lib/libvirt/images/myguest.img"...

Hi All, I have bfu''ed to net-virt_xb-21_snv_81_021308. The dladm command on my machine does not have create-etherstub option. Please let me know what could be the issue. Thanks Khushal

...linux /syslinux/boot.cat /syslinux/boot.msg /syslinux/general.msg /syslinux/initrd.img /syslinux/memtest /syslinux/options.msg /syslinux/param.msg /syslinux/rescue.msg /syslinux/splash.lss /syslinux/TRANS.TBL /syslinux/vmlinuz /syslinux/syslinux.cfg Configuration: default myks timeout 60 ... label myks kernel vmlinuz append initrd=initrd.img ks=hd:sda2:/ks.cfg method=hd:sda2:/centos ... And to be sure: dd if=/usr/lib/syslinux/mbr.bin of=/dev/sdg I remade it to upgrade the OS version (but still (isolinux 3.11-4) and it does not boot anymore... I get to...

...ith Samba 2.7 stable. even groups who to not have "r-x" permission can not copy data. same goes for eveyone with "r-x" no user can copy the data. until i give them "rwx" this wasn't happening previously. is there anyone who can help me in this regard. Thanks, MYK

...other debian machines when i type "apt-get install sam<tab>" it give me all item start from sam and this is a default behavour. however now for some reason <tab> key is not working. is there anyone know why. note: for other commands <tab> key is working fine. Thanks, Myk

...the difference and the fact that you can''t reproduce the crash on CentOS (must be 3.3 ?) Third, there has been a heavy development in opensolaris on he virtual network interface level (so call crossbow) Four, it might also be related to the actual opensolaris driver (which is 3rd party, myk for my Marvell yukon Gb), I could try to test if it''s the same with another one Four, i386 vs amd64 I think it might be useful to copy this thread to the xen mailing list on opensolaris Thanks Bruno _______________________________________________ freebsd-xen@freebsd.org mailing list ht...

Buen día, no sé si estoy utilizando bien la lista, es la primera vez. Si lo hago mal me corrigen por favor. Sobre tu comentario Pedro, muchas gracias. Lo qeu entiendo con tu sugerencia de set.seed es qeu de esa forma fijas los resultados, pero no estoy seguro si otra agrupación funcione mejor. Es decir me interesa un método de agrupación que genere la "mejor" agrupación y como los

...ex<-rep(0,maxk) # hold the si values for each k clusters mdist<-1-cor(t(mydata)) #dissimlarity mdist<-as.dist(mdist) for(k in 2:maxk) { hc<-diana(mdist,diss =TRUE, stand = FALSE) si<-silhouette.default(cutree(as.hclust(hc),k=k),mdist) myindex<-summary(si)$avg.width } myk<-rev(order(myindex))[1] #select the number of k clusters with the #largest si value I met the following problems: > for(k in 2:maxk) + { + hc<-diana(mdist,diss =TRUE, stand = FALSE) + si<-silhouette.default(cutree(as.hclust(hc...

...llation. (then it list down everything correctly from domain) is there anyone who can tell me from where both the users are coming. and how can i fix this issue. i am actually playing with some scripts and these wrong users (local user instead of domain) are hurdling my work thanks in advance. MYK

...;Virt-manager" GuI is running on the back end. so that i can learn how it add,edit,delete some advance level of configuration via GUI. i mean like we have "history" command which show what have we run in past so can i also have the details what Virt-manager has run remotely Thanks, MYK

Hi. I am trying to modify kmeans function. It seems that is failing something obvious with the workspace. I am a newbie and here is my code: myk = function (x, centers, iter.max = 10, nstart = 1, algorithm = c("Hartigan-Wong", + "Lloyd", "Forgy", "MacQueen")) + { + do_one <- function(nmeth) { + Z <- switch(nmeth, { + Z <- .Fortran(R_kmns, as.double(x), as.integer(m...

..._RESPAGE=None&FORMAT_OBJECT=Alignment&FORMAT_TYPE=HTML&GAPCOSTS=11+1&I_THRESH=0.001&LAYOUT=TwoWindows&MATRIX_NAME=BLOSUM62&NCBI_GI=on&PAGE=Proteins&PROGRAM=blastp&QUERY=MVCDKCEKKLSKVIVPDKWKDGARNVTEGGGRKINENKLLSKKNRWSPYSTCTTKCMICKQQVHQDGKYCHTCAYSKGVCAMCGKQVLDTKMYKQSNV&SERVICE=plain&SET_DEFAULTS.x=9&SET_DEFAULTS.y=5&SHOW_OVERVIEW=on&WORD_SIZE=3&END_OF_HTTPGET=Yes\" TARGET=\"_blank\">At1g61780</A> against nr\nUnformatted <A HREF=\"../cgi/getseq.pl?GabiMips+At1g61780+seq\" TARGET=\"_blank\"&...

Hola, I've done everything as correct as I can see in smb.conf under fresh ubuntu 6.06 fully updated install to have it run as a PDC on hostname florentine, domain DAVEYST. There are no testparm errors. I've added users with useradd and smbpasswd -a I've added machines with useradd and smbpasswd -a -m I can see the server in my network neighbourhood and access/browse folders on