similar to: Calculating p-values from your own distribution as an array

HI, this is my problem I want to subset this file df, using only unique df$exon printing the line once even if df$exon appear several times: unique(df$exon) will show me the unique exons If I try to print only the unique exon lines with df[unique(df$exon),] -this doesn't print only the unique ones :( could you help? thanks Nat exon size chr start

Hi R friends, I've been attempting to create plots with multiple alpha values using Cairo to save them on a windows (32b XP) platform as it doesn't support more than 3 alpha values. This worked well until I wanted a postscript file (unsupported) and as a attempted work around I installed RGtk2. So far so good, however now when I try to use a >CairoPDF("alpha.pdf", 6, 6,

Hello, I have a question about using extreme value distribution in R. I have two variables, X and Y, and have pairs of points (X1,Y1),(X2,Y2), (X3,Y3) etc. When I plot X against Y, it looks like the maximum value of Y (for a particular X) is correlated with X. Indeed, when I bin the data by X-value into equally sized bins, and test whether the maximum value of Y for a bin is correlated with

Hi, I do not get how par works, help please. Let's say I have a simple plot: plot(1:10) I want to change the font size for the x axis... how do I do that? Thank you, Stephane -- The Wellcome Trust Sanger Institute is operated by Genome Research Limited, a charity registered in England with number 1021457 and a compa ny registered in England with number 2742969,

Hi everybody, I've been looking around, but can't seem to find the answer. I get a list of names (which vary, so I never know them in advance), and transform them into variables, each of which is a dataframe, using assign: polyList <- c("rs123", "rs124", "rs555", "rs000") numPoly <- length(polyList) for (k in 1:numPoly) {

Hello, The 179th and 180th elements of my list of lists look like this: [[179]] [[179]]$desc [1] ">ipi|IPI00646510|IPI00646510.2 ISOFORM P60-HCK OF TYROSINE-PROTEIN KINASE HCK." [[179]]$seq [1] "MGGRSSCEDPGCPRDEERAPRMGCMKSKFLQVGGNTFSKTETSASPHCPVYVPDPTSTIKPGPNSHNSNTP GIREAGSEDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVDSLETEE

Hi, I'm trying to get a plot ready for publication, which involves getting it to look nice at a rather small size and to fine-tune positioning all the labels and sizes of the margins. I realise that I may not be doing this the right way and I welcome any comments about better approaches to do this. What I have done so far is open an X11 device with the size I want for the final output and I

Hello, I need a specific version of R installed for consistency reasons. I do the standard setup steps: echo "deb https://cran.ma.imperial.ac.uk/bin/linux/ubuntu trusty/" | sudo tee -a /etc/apt/sources.list sudo apt-key adv --keyserver keyserver.ubuntu.com --recv-keys E084DAB9 sudo apt-get update And then a simple install call, which used to work just fine some time ago, tosses an

Hi, I would like some extra information on the 'cgh' package in R. I noticed that there isn't much activity regarding this package on the R and BioC mailing list (I googled it). I started using this package and I have few questions: 1/ As I have a custom tiling like array @8um features resolution (affy), I have a lot of probes to work with. I'm assuming it is correct to

To whom it may concern: My OS: CentOS 5.5 R version: R-2.11.1 My questions are as follows: First, I inputted commands: ----------------------------- # ./configure --enable-R-shlib # make # make check ----------------------------- Everything goes well until "make check". screen log: ************************************** make[1]: Entering directory `/tmp/R-2.11.1/tests' make[2]:

I am running dovecot 2.2.2 with tcp based replication, and experiencing some duplicated emails. `doveconf -n` output is below. I have narrowed it down to the following scenario: An email arrives, and is successfully replicated to both nodes. It is in INBOX/new/ at this point on both servers. Connect with a mail client, and delete the message - without delayed expunge. So, for example, mutt

Hi - I am interested in solving variance components for the data below with respect to the response variable, Expression within R. However, the covariates aren't independent and they also have a class (of which the total variance explained by covariates in that class I am most interested in). Very naively, I have tried to look at each individual covariates variance like this >

Hi I hope someone can shed some light on this: For some reason when I read.table("bfx.txt") R decides to only give back the first character from each column in each row as one single column. Like this: V1 1 ÿþr 2 \n 3 r 4 1 5 0 6 A 7 G 8 \n 9 r 10 1 11 0 12 T 13 C 14 \n The data should be:

First, apologies for no example data but I don't think it's needed in this case, Q: Can (and if so how ) the line end style be changed for 'cloud' plots? I've tried par(lend=2), trellis.par.set(add.line = list(lend=2)) and much googling but to no avail Thanks in advance Dan P.S. the reason for this is that the round end looks bad at lwd=3 or more Daniel Alcock Malaria

I am running two servers with Dovecot v2.2.12 on CentOS x86_64 (5.10 and 6.5 respectively) and users are virtual over ldap. I have setup our main internal server (vmail.example.com) with dsync replication according to the first part of http://wiki2.dovecot.org/Replication. The second one (vmail1.example.com) will be the failover server which we want to be a real-time mirror (but can be

Hello List I have a strange problem here which i try to analyse, but i'm stuck. Maybe someone has a hint? What happened: A few weeks ago one of the LDAPS Servers which is not maintained by us has crashed. From that moment on, users could still login to check their emails, but they were not able to send any email through postfix (which uses smtpd_sasl_type = dovecot) What i do not

Hi, I'm using read.table in a loop, to read in multiple files. The problem is that when a file is missing there is an error message and the loop is broken; what I'd like to do is to test for the error and simply do "next" instead of breaking the loop. Anybody knows how to do that? Example: filelist <- c("file1.txt", "file2.txt",

Hello - I am trying to figure out R's transformation for interaction terms in a linear regression. My simple background understanding is that interaction terms are generally calculated by multiplying the centred (0-mean) variables with each other and then doing the regression. However, in this regard I would have expected to see the same p-value when I calculate summary(lm(Y~A:B)) for A:B

Hello Please find bug report attached. Thanks Matthew -- Matthew Gillman Team 105: Variation Informatics Wellcome Trust Sanger Institute, Wellcome Trust Genome Campus, Hinxton, Cambridge, CB10 1SA, UK Tel: 01223 834244 Ext. 4922 -- The Wellcome Trust Sanger Institute is operated by Genome Research Limited, a charity registered in England with number 1021457 and a company registered

Dear Krzysztof, I would suggest to have a look at Docker images. https://hub.docker.com/r/rocker/r-ver/ provides images for different versions of R. You could even create your own image with all the packages and other dependencies that you need. See e.g. our image at https://hub.docker.com/r/inbobmk/rstable/ Best regards, ir. Thierry Onkelinx Statisticus / Statistician Vlaamse Overheid /