similar to: Creating a Hash from Data.Frame

Hi, I have the following data file to be parsed and captured as a data frame: __DATA__ #GDS_ID GENE_NAME GENE_DESCRIPTION GENE_FUNCTION 1007_s_at | DDR1 | discoidin domain receptor tyrosine kinase 1 | protein-coding 1053_at | RFC2 | replication factor C (activator 1) 2, 40kDa | protein-coding 117_at | HSPA6 | heat shock 70kDa protein 6 (HSP70B') | protein-coding __END__ In particular it is

Hi, I have the following function: > kurtosis <-function(x) (mean((x-mean(x))^4))/(sd(x)^4) #x is a vector and data > print(mydata) V1 V2 V3 V4 V5 1 1007_s_at DDR1 2865.1 2901.3 1978.3 2 1053_at RFC2 103.6 81.6 108.0 3

Hi, i have two files (file1.txt and file2.txt) which i would like to merge, based on certain criteria, i.e. it combines data based on matching geneID and exons. i have used the merge option, but it does not give me the desired outcome. merged.txt shows the result i would like. *File1. txt* ** AffyProbe ProbeType Flag GeneSymbol GeneID Exons Chrom Strand Affytart AffyEnd 1

Hi all, Suppose I have a vector like this: [1] "STAT1" "STAT1" "STAT1" "STAT1" "GAPDH" "GAPDH" "GAPDH" "ACTB" "ACTB" [10] "ACTB" "DDR1" "RFC2" "HSPA6" "PAX8" "GUCA1A" "UBE1L" "THRA" "PTPN21" [19]

Dear all, Here is my code which am using to combine 5th column from different data sets. Here is the function to do my job genesymbol.append.file <-NULL gene.column <- NULL readGeneSymbol <- function(files,genesymbol.column=5){ for(i in fnames){ temp <- read.table(fnames,header=T,sep="\t",stringsAsFactors=F,quote="\"")

Hello, The 179th and 180th elements of my list of lists look like this: [[179]] [[179]]$desc [1] ">ipi|IPI00646510|IPI00646510.2 ISOFORM P60-HCK OF TYROSINE-PROTEIN KINASE HCK." [[179]]$seq [1] "MGGRSSCEDPGCPRDEERAPRMGCMKSKFLQVGGNTFSKTETSASPHCPVYVPDPTSTIKPGPNSHNSNTP GIREAGSEDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVDSLETEE

hi all i started recently using R and i found myself stuck when i try to analyze microarray data. i use the "affy" package to obtain the intensities of the probes, i have two CTRs and two treated. HG.U133A.Experiment1.CEL HG.U133A.Experiment2.CEL HG.U133A_Control1.CEL HG.U133A_Control2.CEL 1007_s_at 2156.23115 467.75615 364.60615 362.11865

hell all: I have a vector as follows: > head(res) 1007_s_at.value 1053_at.value 117_at.value 121_at.value 1255_g_at.value 0.225801033 0.009747404 0.709517954 0.008825740 0.496859178 1294_at.value 0.005091231 after I convert the res into a data frame I got the following: resx<- data.frame(res) > head(resx) res

Hi, i have two files (file1.txt and file2.txt) which i would like to merge, based on certain criteria, i.e. it combines data based on matching geneID and exons. i have used the merge option, but it does not give me the desired outcome. merged.txt shows the result i would like. *File1. txt* ** AffyProbe ProbeType Flag GeneSymbol GeneID Exons Chrom Strand Affytart AffyEnd 1

Dear mailing list, I have a C function that gives me a wrong result when I run it under Windows 7. This is the code under Linux (RHEL5): > library(phenoTest) > data(epheno) > sign <- sample(featureNames(epheno))[1:20] > score <- getFc(epheno)[,1] > head(score) 1007_s_at 1053_at 117_at 121_at 1255_g_at 1294_at -1.183019 1.113544 1.186186 -1.034779 -1.044456

Hi Everyone, I am very new to R. When i run the code yesterday, it was working fine. I was able to find gene annotation. somehow, today, when i try to run it again, it is giving me errors message that i don't understand. It says that it cannot open file. what file is it looking for? ###################################################### ##make sure to install and load annotationtool in R

Hi all, I originally posted this to the bioconductor group, but maybe it's better suited to the r-help... I'm using som() to partition samples of gene expression data into clusters. The point is to classify control vs. experimental cases (sample clustering). The original matrix was 22283 x 8. The 8 samples have 4 controls and 4 experimentals. I transposed the matrix so that its dim

Good afternoon all - While making a steady progress in learning R after Matlab I encountered a problem which seems to require some extra help to move over. Basically I want to merge a data from biological statistical dataset with annotation data extracted from another dataset using an 'id' crossreference and write it to report file. The first part goes absolutely fine, I have merged both

Hi All, I wonder if there should be one character for quote= in read.table, i.e., > args(read.table) function (file, header = FALSE, sep = "", quote = "\"'", dec = ".", ... I have a file containing the following lines, 08248-GOTERM 3'-phosphoadenosine 5'-phosphosulfate biosynthetic process 08279-GOTERM 3'-phosphoadenosine

Hi list, I have a question about using *read.table()* to read in a txt file. Basically, it consists of 16346 rows, 6 columns (no header). The code I used is: exprSet <- read.table('process_all4_GSA2.txt', row.names = 1,header =FALSE) and I got an error message: > exprSet <- read.table('process_all4_GSA2.txt', row.names = 1,header =FALSE) Error in

Dear all, I try to use read.table to get the data from a tab delimited file, and some of the data is shown below: 3185 heterogeneous nuclear ribonucleoprotein F 3187 heterogeneous nuclear ribonucleoprotein H1 (H) 3188 heterogeneous nuclear ribonucleoprotein H2 (H') 3189 heterogeneous nuclear ribonucleoprotein H3 (2H9) 3190 heterogeneous nuclear ribonucleoprotein K ///

Lots of 3D games such as Team Fortress 2, Audiosurf or Stalker have very low performance in comparison to running on the same computer on Windows. What can I do to improve it? What developers have still to implement to fully support 3D rendering?

ciao, ho aperto un file in R di classe data frame di 15000 righe e 29 colonne. Nella console però sono visualizzate solo la prima e l'ultima colonna e le ultime 8000 righe circa. E' possibile una visualizzazione completa? Grazie Sabrina [[alternative HTML version deleted]]

COMPUTATIONAL ANALYSIS OF NEXT GENERATION SEQUENCE DATA (http://bioinformatics.nki.nl/vacancies.php) THREE BIOINFORMATICS POSITIONS PROJECT OUTLINE Genomic alterations are major determinant of responses to (targeted) therapies in cancer. In fact, the best positive and negative predictors of responses to targeted therapies are alterations in kinases or their direct downstream effectors. To

Hi, First a bit of disclaimer... I haven't isolated this problem into an easy to reproduce case, and I won't be surprised if the root cause is a fault in my code's use of name spaces or some such. The error I'm seeing is one in which the desired method is not found. What worries me in terms of my expectations of how to debug the problem is that showMethods and selectMethod both