similar to: Separator with " | " for read.table

Hi, I have the following data frame: > print(mydatframe) __DATAFRAME__ V1 V2 V3 1 1007_s_at DDR1 discoidin domain receptor tyrosine kinase 1 2 1053_at RFC2 replication factor C (activator 1) 2, 40kDa 3 117_at HSPA6 heat shock 70kDa protein 6 (HSP70B') __END__ Is there a way to create a hash with V2 as Key and V3 as its value? - Gundala Viswanath Jakarta - Indonesia

Hi all, Suppose I have a vector like this: [1] "STAT1" "STAT1" "STAT1" "STAT1" "GAPDH" "GAPDH" "GAPDH" "ACTB" "ACTB" [10] "ACTB" "DDR1" "RFC2" "HSPA6" "PAX8" "GUCA1A" "UBE1L" "THRA" "PTPN21" [19]

Hi, I have the following function: > kurtosis <-function(x) (mean((x-mean(x))^4))/(sd(x)^4) #x is a vector and data > print(mydata) V1 V2 V3 V4 V5 1 1007_s_at DDR1 2865.1 2901.3 1978.3 2 1053_at RFC2 103.6 81.6 108.0 3

Hi, i have two files (file1.txt and file2.txt) which i would like to merge, based on certain criteria, i.e. it combines data based on matching geneID and exons. i have used the merge option, but it does not give me the desired outcome. merged.txt shows the result i would like. *File1. txt* ** AffyProbe ProbeType Flag GeneSymbol GeneID Exons Chrom Strand Affytart AffyEnd 1

Hello, The 179th and 180th elements of my list of lists look like this: [[179]] [[179]]$desc [1] ">ipi|IPI00646510|IPI00646510.2 ISOFORM P60-HCK OF TYROSINE-PROTEIN KINASE HCK." [[179]]$seq [1] "MGGRSSCEDPGCPRDEERAPRMGCMKSKFLQVGGNTFSKTETSASPHCPVYVPDPTSTIKPGPNSHNSNTP GIREAGSEDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVDSLETEE

Dear all, Here is my code which am using to combine 5th column from different data sets. Here is the function to do my job genesymbol.append.file <-NULL gene.column <- NULL readGeneSymbol <- function(files,genesymbol.column=5){ for(i in fnames){ temp <- read.table(fnames,header=T,sep="\t",stringsAsFactors=F,quote="\"")

Hi, i have two files (file1.txt and file2.txt) which i would like to merge, based on certain criteria, i.e. it combines data based on matching geneID and exons. i have used the merge option, but it does not give me the desired outcome. merged.txt shows the result i would like. *File1. txt* ** AffyProbe ProbeType Flag GeneSymbol GeneID Exons Chrom Strand Affytart AffyEnd 1

Hi list, I have a question about using *read.table()* to read in a txt file. Basically, it consists of 16346 rows, 6 columns (no header). The code I used is: exprSet <- read.table('process_all4_GSA2.txt', row.names = 1,header =FALSE) and I got an error message: > exprSet <- read.table('process_all4_GSA2.txt', row.names = 1,header =FALSE) Error in

Dear all, I try to use read.table to get the data from a tab delimited file, and some of the data is shown below: 3185 heterogeneous nuclear ribonucleoprotein F 3187 heterogeneous nuclear ribonucleoprotein H1 (H) 3188 heterogeneous nuclear ribonucleoprotein H2 (H') 3189 heterogeneous nuclear ribonucleoprotein H3 (2H9) 3190 heterogeneous nuclear ribonucleoprotein K ///

Hey everyone, I am an R-newby... so sorry for bothering you with simple-to-solve questions;) I have the following issue: trying to add labels to my scatterplots (with geom_dl in ggplot2). Everything works fine, but after checking every resource I do not find a way to change the font size of my labels. I tried size, cex, fontsize at every position... but it always stays the same. ggplot()+

Tom, I think it might be productive to fork this thread to discuss making the requirements for upstreaming a new LLVM target more explicit and open. I'd also like to gauge interest in an idea I've discussed privately with a few community members, namely the concept of having a semi-official "incubation" system whereby proposed backends could get a trial run before becoming part

Dear all, Does R offer a means by which a function can determine whether its return value is assigned? I am using R 2.4.1 for Windows. Suppose what I am looking for is called "return.value.assigned". Then one might use it like this myfunction <- function () { # Create bigobject here if (return.value.assigned()) { bigobject } else {