similar to: lost ability to apt-get install r-base=3.4.2-1trusty1

Dear Krzysztof, I would suggest to have a look at Docker images. https://hub.docker.com/r/rocker/r-ver/ provides images for different versions of R. You could even create your own image with all the packages and other dependencies that you need. See e.g. our image at https://hub.docker.com/r/inbobmk/rstable/ Best regards, ir. Thierry Onkelinx Statisticus / Statistician Vlaamse Overheid /

Hi: I have a Dockerfile, which builds an image which installed R 3.3.2 in Ubuntu 14.04, but building using that Dockerfile seems to have stopped working and I am unclear why. I believe the relevant error is: Some packages could not be installed. This may mean that you have requested an impossible situation or if you are using the unstable distribution that some required packages have not yet

Dear all, I am trying to use the rstable(n, alpha, beta, gamma = 1, delta = 0, pm = c(0, 1, 2))) function to generate positive stable random numbers. For positive stable distribution, beta==1 and alpha is in (0,1), which defines random variables with support (0, infinity). So, I used rstable(100, 0.5, 1) for an example. I found that this gives me some negative numbers. For example, >

I have a R script that I call from python using rpy2. It uses dplyr, doBy, and ggplot2. The script has install.packages commands for these 3 packages. Even thought the packages are already installed it still downloads, builds, and installs them, which is very time consuming. Is there a way to have it only do the install if the package is not already installed? Also, I run in a docker container,

I have a chromebook with a fresh minimal install of Ubuntu 14.04 running through crouton, and I'm trying to install the latest version of R. The only thing I have done to the system before trying to install R is install gedit. When I try to install R I get an unmet dependencies error that complains that the version of r-base-core available isn't new enough. I followed the instructions at

Dear all, I am having difficulty interpreting the parameter estimates from the stablereg function. Specifically I am trying to keep things simple to start with by using stablereg to fit a normal distribution to a simulated data set from that distribution (in order to understand the way that stablereg reports parameter estimates). I cannot work out the scale on which the dispersion parameter (some

Hi everyone, when I use the two sample Kolmogorov¨CSmirnov ks2Test like this: x=read.table("e:/x.txt") y=rstable(1000,alpha,beta,gamma,delta) I alway get results as follows: Warning messages: 1: In ks.test(x = x, y = y, alternative = "two.sided") : cannot compute correct p-values with ties 2: In ks.test(x = x, y = y, exact = TRUE, alternative = "two.sided")

I am trying to add Michael Rutter's ppa to my repository.? I cannot do this from the command line.? I think I may be behind a firewall so copying the key to a text file is my best option.? When I search for the key at http://keyserver.ubuntu.com:11371/ the search fails. Tried typing and cutting and pasting E084DAB9 into the search box without success. How can I get the key?

HI, this is my problem I want to subset this file df, using only unique df$exon printing the line once even if df$exon appear several times: unique(df$exon) will show me the unique exons If I try to print only the unique exon lines with df[unique(df$exon),] -this doesn't print only the unique ones :( could you help? thanks Nat exon size chr start

Hi R friends, I've been attempting to create plots with multiple alpha values using Cairo to save them on a windows (32b XP) platform as it doesn't support more than 3 alpha values. This worked well until I wanted a postscript file (unsupported) and as a attempted work around I installed RGtk2. So far so good, however now when I try to use a >CairoPDF("alpha.pdf", 6, 6,

Hello, I have a question about using extreme value distribution in R. I have two variables, X and Y, and have pairs of points (X1,Y1),(X2,Y2), (X3,Y3) etc. When I plot X against Y, it looks like the maximum value of Y (for a particular X) is correlated with X. Indeed, when I bin the data by X-value into equally sized bins, and test whether the maximum value of Y for a bin is correlated with

Hi, I do not get how par works, help please. Let's say I have a simple plot: plot(1:10) I want to change the font size for the x axis... how do I do that? Thank you, Stephane -- The Wellcome Trust Sanger Institute is operated by Genome Research Limited, a charity registered in England with number 1021457 and a compa ny registered in England with number 2742969,

Hi everybody, I've been looking around, but can't seem to find the answer. I get a list of names (which vary, so I never know them in advance), and transform them into variables, each of which is a dataframe, using assign: polyList <- c("rs123", "rs124", "rs555", "rs000") numPoly <- length(polyList) for (k in 1:numPoly) {

Hello, The 179th and 180th elements of my list of lists look like this: [[179]] [[179]]$desc [1] ">ipi|IPI00646510|IPI00646510.2 ISOFORM P60-HCK OF TYROSINE-PROTEIN KINASE HCK." [[179]]$seq [1] "MGGRSSCEDPGCPRDEERAPRMGCMKSKFLQVGGNTFSKTETSASPHCPVYVPDPTSTIKPGPNSHNSNTP GIREAGSEDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVDSLETEE

Hi - If I have a hypothetical distribution as an array distribution<-c(0,1,2,3,4,5,6,7,8,9) and I want to find the probability there is a value smaller than a new value. new_value<-4 (such that I'd get this type of output) new_value p-value 4 0.5 3.4 0.4 3 0.4 0 0.1 -1 0.0 Thanks for the help, I bet this is really easy... :/ Stephen -- The Wellcome Trust Sanger Institute is

Hi, I would like some extra information on the 'cgh' package in R. I noticed that there isn't much activity regarding this package on the R and BioC mailing list (I googled it). I started using this package and I have few questions: 1/ As I have a custom tiling like array @8um features resolution (affy), I have a lot of probes to work with. I'm assuming it is correct to

Hi I hope someone can shed some light on this: For some reason when I read.table("bfx.txt") R decides to only give back the first character from each column in each row as one single column. Like this: V1 1 ÿþr 2 \n 3 r 4 1 5 0 6 A 7 G 8 \n 9 r 10 1 11 0 12 T 13 C 14 \n The data should be:

Hi, I'm trying to get a plot ready for publication, which involves getting it to look nice at a rather small size and to fine-tune positioning all the labels and sizes of the margins. I realise that I may not be doing this the right way and I welcome any comments about better approaches to do this. What I have done so far is open an X11 device with the size I want for the final output and I

First, apologies for no example data but I don't think it's needed in this case, Q: Can (and if so how ) the line end style be changed for 'cloud' plots? I've tried par(lend=2), trellis.par.set(add.line = list(lend=2)) and much googling but to no avail Thanks in advance Dan P.S. the reason for this is that the round end looks bad at lwd=3 or more Daniel Alcock Malaria

Hi guys Is there a way in R to simulate/generate random numbers from a negative skewed and fat tailed distribution ? I would like to simulate a set of (discrete) data. Regards, Carlos Carlos http://www.nabble.com/file/p25783889/graph.png graph.png -- View this message in context: http://www.nabble.com/Simulate-negative-skewed%2C-fat-tailed-distribution-tp25783889p25783889.html Sent from the