Displaying 20 results from an estimated 2000 matches similar to: "lost ability to apt-get install r-base=3.4.2-1trusty1"
2018 Jan 17
0
lost ability to apt-get install r-base=3.4.2-1trusty1
Dear Krzysztof,
I would suggest to have a look at Docker images.
https://hub.docker.com/r/rocker/r-ver/ provides images for different
versions of R. You could even create your own image with all the
packages and other dependencies that you need. See e.g. our image at
https://hub.docker.com/r/inbobmk/rstable/
Best regards,
ir. Thierry Onkelinx
Statisticus / Statistician
Vlaamse Overheid /
2017 Apr 19
4
difficulty in Ubuntu 14.04 apt-getting R 3.3.2
Hi:
I have a Dockerfile, which builds an image which installed R 3.3.2 in
Ubuntu 14.04, but building using that Dockerfile seems to have stopped
working and I am unclear why.
I believe the relevant error is:
Some packages could not be installed. This may mean that you have
requested an impossible situation or if you are using the unstable
distribution that some required packages have not yet
2005 Aug 30
2
problem in generating positive stable random numbers
Dear all,
I am trying to use the
rstable(n, alpha, beta, gamma = 1, delta = 0, pm = c(0, 1, 2)))
 function to generate positive stable random numbers. For positive stable
distribution, beta==1 and alpha is in (0,1), which defines random variables
with support (0, infinity). So, I used rstable(100, 0.5, 1) for an example.
I found that this gives me some negative numbers. For example,
>
2017 Nov 29
5
Preventing repeated package installation, or pre installing packages
I have a R script that I call from python using rpy2. It uses dplyr, doBy,
and ggplot2. The script has install.packages commands for these 3 packages.
Even thought the packages are already installed it still downloads,
builds, and installs them, which is very time consuming. Is there a way to
have it only do the install if the package is not already installed?
Also, I run in a docker container,
2003 Mar 25
1
Help : stablereg parameter interpretation
Dear all,
I am having difficulty interpreting the parameter estimates from the stablereg
function. Specifically I am trying to keep things simple to start with by
using stablereg to fit a normal distribution to a simulated data set from
that distribution (in order to understand the way that stablereg reports
parameter estimates). I cannot work out the scale on which the dispersion
parameter (some
2016 Mar 21
3
Outdated r-base-core when installing on Ubuntu 14.04
I have a chromebook with a fresh minimal install of Ubuntu 14.04 running
through crouton, and I'm trying to install the latest version of R. The
only thing I have done to the system before trying to install R is install
gedit. When I try to install R I get an unmet dependencies error that
complains that the version of r-base-core available isn't new enough.
I followed the instructions at
2008 Jul 06
2
Hi~problem with the two sample test: ks2Test in the package of fbasics
Hi everyone, when I use the two sample Kolmogorov¨CSmirnov ks2Test like this:
 x=read.table("e:/x.txt")
 y=rstable(1000,alpha,beta,gamma,delta)
  
 I alway get  results as follows:
 Warning messages:
1: In ks.test(x = x, y = y, alternative = "two.sided") :
  cannot compute correct p-values with ties
2: In ks.test(x = x, y = y, exact = TRUE, alternative = "two.sided")
2012 Mar 18
2
Secure apt
I am trying to add Michael Rutter's ppa to my
repository.? I cannot do this from the command
line.? I think I may be behind a firewall so copying
the key to a text file is my best option.? When I
search for the key at 
http://keyserver.ubuntu.com:11371/
the search fails.  Tried typing and 
cutting and pasting E084DAB9 into 
the search box without success.  How 
can I get the key?
2012 Mar 02
3
subseting a data frame
HI,
this is my problem I want to subset this file df, using only  unique 
df$exon printing the line once even if  df$exon appear several times:
unique(df$exon) will show me the unique exons
If I try to print only the unique exon lines
with df[unique(df$exon),] -this doesn't print only the unique ones :(
could you help?
thanks
Nat
                         exon size  chr     start      
2010 Apr 27
1
Cairo package failure to load backend
Hi R friends,
I've been attempting to create plots with multiple alpha values using
Cairo to save them on a windows (32b XP) platform as it doesn't support
more than 3 alpha values. This worked well until I wanted a postscript
file (unsupported) and as a attempted work around I installed RGtk2. So
far so good, however now when I try to use a 
>CairoPDF("alpha.pdf", 6, 6,
2007 Nov 22
3
question about extreme value distribution
Hello,
I have a question about using extreme
value distribution in R. 
I have two variables, X and Y, and have pairs
of points (X1,Y1),(X2,Y2), (X3,Y3) etc.
When I plot X against Y, it looks 
like the maximum value of Y (for a particular X) is
correlated with X.
Indeed, when I bin the data by X-value into
equally sized bins, and test whether the maximum 
value of Y for a bin is correlated with
2008 Aug 06
4
Font size in plots (I do NOT understand par help)
Hi,
 
I do not get how par works, help please.
 
Let's say I have a simple plot: plot(1:10)
 
I want to change the font size for the x axis... how do I do that?
 
Thank you,
 
Stephane
-- 
 The Wellcome Trust Sanger Institute is operated by Genome Research 
 Limited, a charity registered in England with number 1021457 and a 
 compa
ny registered in England with number 2742969,
2008 Jul 08
2
attributing values to dataframe positions following eval
Hi everybody,
 
I've been looking around, but can't seem to find the answer.
 
I get a list of names (which vary, so I never know them in advance), and
transform them into variables, each of which is a dataframe, using
assign:
 
polyList <- c("rs123", "rs124", "rs555", "rs000")
numPoly <- length(polyList)
 
for (k in 1:numPoly) {
 
2009 Apr 23
1
Accessing all the first sub-elements of a list of list
Hello,
 
The 179th and 180th elements of my list of lists look like this:
 
[[179]]
[[179]]$desc
[1] ">ipi|IPI00646510|IPI00646510.2 ISOFORM P60-HCK OF TYROSINE-PROTEIN
KINASE HCK."
 
[[179]]$seq
[1]
"MGGRSSCEDPGCPRDEERAPRMGCMKSKFLQVGGNTFSKTETSASPHCPVYVPDPTSTIKPGPNSHNSNTP
GIREAGSEDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVDSLETEE
2009 Jan 09
1
Calculating p-values from your own distribution as an array
Hi -
If I have a hypothetical distribution as an array
distribution<-c(0,1,2,3,4,5,6,7,8,9)
and I want to find the probability there is a value smaller than a new
value.
new_value<-4
(such that I'd get this type of output)
new_value	p-value
4	0.5
3.4	0.4	
3	0.4
0	0.1
-1	0.0
Thanks for the help, I bet this is really easy... :/ 
Stephen
-- 
 The Wellcome Trust Sanger Institute is
2007 Dec 19
1
FW: cgh package
Hi, 
I would like some extra information on the 'cgh' package in R. I noticed
that there isn't much activity regarding this package on the R and BioC
mailing list (I googled it). 
 
I started using this package and I have few questions:
1/ As I have a custom tiling like array @8um features resolution (affy),
I have a lot of probes to work with. I'm assuming it is correct to
2009 Nov 17
1
strange read.table results
Hi I hope someone can shed some light on this:
 
For some reason when I 
 
read.table("bfx.txt")
 
R decides to only give back the first character from each column in each row as one single column.
 
Like this:
 
    V1
1   ÿþr
2    \n
3     r
4     1
5     0
6     A
7     G
8    \n
9     r
10    1
11    0
12    T
13    C
14   \n
 
The data should be:
 
2011 Mar 08
2
positions and margins differ between X11 and SVG device
Hi,
I'm trying to get a plot ready for publication, which involves getting
it to look nice at a rather small size and to fine-tune positioning all
the labels and sizes of the margins.
I realise that I may not be doing this the right way and I welcome any
comments about better approaches to do this. What I have done so far is
open an X11 device with the size I want for the final output and I
2010 Apr 06
1
lattice package: line end style
First, apologies for no example data but I don't think it's needed in
this case,
Q: Can (and if so how ) the line end style be changed for 'cloud' plots?
I've tried par(lend=2),  trellis.par.set(add.line = list(lend=2)) and
much googling but to no avail
Thanks in advance
Dan
P.S. the reason for this is that the round end looks bad at lwd=3 or
more
Daniel Alcock
Malaria
2009 Oct 07
1
Simulate negative skewed, fat-tailed distribution
Hi guys
Is there a way in R to simulate/generate random numbers from a negative
skewed and fat
tailed distribution ? I would like to simulate a set of (discrete) data.
Regards,
Carlos
Carlos http://www.nabble.com/file/p25783889/graph.png graph.png 
-- 
View this message in context: http://www.nabble.com/Simulate-negative-skewed%2C-fat-tailed-distribution-tp25783889p25783889.html
Sent from the