similar to: BTRFS misdetects NBD (Network Block Devices) as SSD

Hi, I'm running OpenStack on CentOS 6.3 to manage lxc instances. And running into series of problem relating libvirt and lxc interaction. For example, libvirt_lxc segfault ( https://bugzilla.redhat.com/show_bug.cgi?id=874549) which has an upstream fix. And another bugs such as fail to start when SELinux disabled. Finally, I decides to adopt libvirt 0.10.2, self compiled from

Dear Devs, Would there be any problem to use nbd (/dev/ndX) devices to gain btrfs-raid across multiple physical hosts across a network? (For a sort of btrfs-drbd! :-) ) Regards, Martin http://en.wikipedia.org/wiki/Network_block_device http://www.drbd.org/ -- To unsubscribe from this list: send the line "unsubscribe linux-btrfs" in the body of a message to majordomo@vger.kernel.org

Hi RIch It got solved.I updated the newer vmlinuz file with the older one after enabling the virtio modules with (m) option. Thanks for the wonderful support you provided me.I'll now ryo to boot my VM from the cloud and let you know if any further issues. I'm now getting following logs... libguestfs-test-tool ************************************************************ *

Hi, I''m relatively new to xen but do never the less very much like the concept & trying to run xen on a production-web-sever. "Trying" because problems start to arrise and the circumstances are rather strange: (But quit to describe) When running imagemagick from apache mysql crashes with a Signal 11. (sometimes). The other strange thing is that no swapspace at all is

Hello, The 179th and 180th elements of my list of lists look like this: [[179]] [[179]]$desc [1] ">ipi|IPI00646510|IPI00646510.2 ISOFORM P60-HCK OF TYROSINE-PROTEIN KINASE HCK." [[179]]$seq [1] "MGGRSSCEDPGCPRDEERAPRMGCMKSKFLQVGGNTFSKTETSASPHCPVYVPDPTSTIKPGPNSHNSNTP GIREAGSEDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVDSLETEE

On Thu, Jun 12, 2014 at 05:08:37PM +0530, abhishek jain wrote: > Hi Rich > > I have all the virtio modules available in the kernel but I'm getting the > same result . It doesn't appear to be using any kernel modules. I would have expected to see output such as this: supermin: internal insmod virtio.ko It seems as if you might not be setting SUPERMIN_MODULES; or maybe you

I'm pleased to announce the release of nbdkit 1.20, a high performance plugin-based Network Block Device (NBD) server. https://en.wikipedia.org/wiki/Network_block_device Key features of nbdkit: * Multithreaded NBD server written in C with good performance. * Minimal dependencies for the basic server. * Liberal license (BSD) allows nbdkit to be linked to proprietary libraries or

Hello all, All SSH/Datafellows versions don't match properly in compat.c. This should be fixed in OpenBSD version, naturally. An example of this is: debug: match: 2.1.0.pl2 SSH Secure Shell (non-commercial) pat ^2\. The match should definitely be 2.1.0. This is caused by the fact that a requisite space was added to the check when converting to regexp matching on Oct 10; CVS Id 1.24:

I'm pleased to announce the release of nbdkit 1.22, a high performance plugin-based Network Block Device (NBD) server. https://en.wikipedia.org/wiki/Network_block_device Key features of nbdkit: * Multithreaded NBD server written in C with good performance. * Minimal dependencies for the basic server. * Liberal license (BSD) allows nbdkit to be linked to proprietary libraries or

Following a hard drive corruption I have reinstalled the latest version of CentOS and all current patch files. For most applications I selected the default options. By doing this I expected that the packages would play nice with one another and I could customize as necessary. Setting SELinux to enforce I encountered all sorts of problems - but most were resolvable, save for Dovecot,

> /* FIXME: This VAD is a kludge */ > .. and it shows (or hears?) unfortunately. I've run a few tests with it > with my users, and they complain that it misdetects too often... In both > directions. Non-speech is detected as speech more often than before, and > more important it also doesn't detect speech as good as before. > I'd really like to see this

https://bugzilla.mindrot.org/show_bug.cgi?id=1519 Summary: zlib version check is fake in the configure script. installation failure. Product: Portable OpenSSH Version: 5.1p1 Platform: ix86 OS/Version: Linux Status: NEW Severity: major Priority: P2 Component: Build system

I need someone in the NeXT community to apply this to 3.5 and tell me if it solves the mmap issue where it misdetects a working mmap(). My NeXT box is packed up. If you know anyone in Minnesota that wants a 68k-25mhz Slab w/ 2 B&W monitors, 2 keyboards, 2 mice, NeXT printer and OS. Have them email me. I won't ship it, but I have no more time to be handling an OS this old. =) I have no

Jean-Marc Valin wrote: > Hi everyone, > > As you may have guess, Speex 1.2 is slowly approaching, though there's > still a lot left to do so I can't say how long it'll take. I thought > this was the right time to ask if there's anything missing or that can > be improved to make 1.2 better. At this point, it can't be anything > major, but there are still

hello, How can i compile Ogg Tools on QNX and use them (Anyone have experience (Not XP)). I have allready tried but there isn't sys/shm.h so it stops there Thanx Tuukka Make a difference, help support the relief efforts in the U.S. http://clubs.lycos.com/live/events/september11.asp --- >8 ---- List archives: http://www.xiph.org/archives/ Ogg project homepage: http://www.xiph.org/ogg/

Hello, I've been trying to get iTunes working with wine-20041201 without much luck. I am trying this on a Fedora Core 2 machine on AMD64. The wine install seems to have gone ok, i can start notepad.exe etc without a problem. The only application that i will be using on wine will be iTunes(i use gtkpod, but it is isnt without its own quirks) and i cant seem to get it to work. I start an

Hi everyone, As you may have guess, Speex 1.2 is slowly approaching, though there's still a lot left to do so I can't say how long it'll take. I thought this was the right time to ask if there's anything missing or that can be improved to make 1.2 better. At this point, it can't be anything major, but there are still some changes that are possible, e.g: - Improving some

Libvirt doesn't care about security during hot add disk images. It even accepts addition of disk images of other guest running on the host. Steps followed to create this scenario : Started two VMs with following security configurations: vm1: <seclabel type='dynamic' model='selinux' relabel='yes'>

Edit the file called src/EDITME and put the result in a file called Local/Makefile. Then you may proceed ... and next time ... you post an error message you may want to be specific ... not "or something like that" ... On Mon, 21 May 2001, Mager Charles WB wrote: > Again another email ALMOST off the point, but not quite. The first question, > which is to do with samba, is - How

why the install is failing. Do in need to rpm -e on all the 2.07 packages??? Return-Path: <nikolaus@erlm.siemens.de> Delivered-To: samba@lists.samba.org Received: from atlantis.erlm.siemens.de (atlantis.erlm.siemens.de [212.114.202.14]) by lists.samba.org (Postfix) with ESMTP id B884C4278 for <samba@lists.samba.org>; Sun, 27 May 2001 22:05:52 -0700 (PDT) Received: from