similar to: BTRFS misdetects NBD (Network Block Devices) as SSD

Displaying 20 results from an estimated 70 matches similar to: "BTRFS misdetects NBD (Network Block Devices) as SSD"

2012 Nov 08
1
OpenStack+libvirt+lxc: lxcContainerGetSubtree:1199 : Failed to read /proc/mounts
Hi, I'm running OpenStack on CentOS 6.3 to manage lxc instances. And running into series of problem relating libvirt and lxc interaction. For example, libvirt_lxc segfault ( https://bugzilla.redhat.com/show_bug.cgi?id=874549) which has an upstream fix. And another bugs such as fail to start when SELinux disabled. Finally, I decides to adopt libvirt 0.10.2, self compiled from
2013 May 19
1
btrfs pseudo-drbd
Dear Devs, Would there be any problem to use nbd (/dev/ndX) devices to gain btrfs-raid across multiple physical hosts across a network? (For a sort of btrfs-drbd! :-) ) Regards, Martin http://en.wikipedia.org/wiki/Network_block_device http://www.drbd.org/ -- To unsubscribe from this list: send the line "unsubscribe linux-btrfs" in the body of a message to majordomo@vger.kernel.org
2014 Jun 13
2
Re: libguestfs supermin error
Hi RIch It got solved.I updated the newer vmlinuz file with the older one after enabling the virtio modules with (m) option. Thanks for the wonderful support you provided me.I'll now ryo to boot my VM from the cloud and let you know if any further issues. I'm now getting following logs... libguestfs-test-tool ************************************************************ *
2005 Aug 15
0
Strange crashes on xen-box (imagemagick/mysql/swap)
Hi, I''m relatively new to xen but do never the less very much like the concept & trying to run xen on a production-web-sever. "Trying" because problems start to arrise and the circumstances are rather strange: (But quit to describe) When running imagemagick from apache mysql crashes with a Signal 11. (sometimes). The other strange thing is that no swapspace at all is
2009 Apr 23
1
Accessing all the first sub-elements of a list of list
Hello, The 179th and 180th elements of my list of lists look like this: [[179]] [[179]]$desc [1] ">ipi|IPI00646510|IPI00646510.2 ISOFORM P60-HCK OF TYROSINE-PROTEIN KINASE HCK." [[179]]$seq [1] "MGGRSSCEDPGCPRDEERAPRMGCMKSKFLQVGGNTFSKTETSASPHCPVYVPDPTSTIKPGPNSHNSNTP GIREAGSEDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVDSLETEE
2014 Jun 12
2
Re: libguestfs supermin error
On Thu, Jun 12, 2014 at 05:08:37PM +0530, abhishek jain wrote: > Hi Rich > > I have all the virtio modules available in the kernel but I'm getting the > same result . It doesn't appear to be using any kernel modules. I would have expected to see output such as this: supermin: internal insmod virtio.ko It seems as if you might not be setting SUPERMIN_MODULES; or maybe you
2020 May 02
0
ANNOUNCE: nbdkit 1.20 - high performance NBD server
I'm pleased to announce the release of nbdkit 1.20, a high performance plugin-based Network Block Device (NBD) server. https://en.wikipedia.org/wiki/Network_block_device Key features of nbdkit: * Multithreaded NBD server written in C with good performance. * Minimal dependencies for the basic server. * Liberal license (BSD) allows nbdkit to be linked to proprietary libraries or
2000 Dec 02
1
PATCH: Datafellows SSH misdetection in compat.c
Hello all, All SSH/Datafellows versions don't match properly in compat.c. This should be fixed in OpenBSD version, naturally. An example of this is: debug: match: 2.1.0.pl2 SSH Secure Shell (non-commercial) pat ^2\. The match should definitely be 2.1.0. This is caused by the fact that a requisite space was added to the check when converting to regexp matching on Oct 10; CVS Id 1.24:
2020 Aug 27
0
ANNOUNCE: nbdkit 1.22 - high performance NBD server
I'm pleased to announce the release of nbdkit 1.22, a high performance plugin-based Network Block Device (NBD) server. https://en.wikipedia.org/wiki/Network_block_device Key features of nbdkit: * Multithreaded NBD server written in C with good performance. * Minimal dependencies for the basic server. * Liberal license (BSD) allows nbdkit to be linked to proprietary libraries or
2009 Apr 30
2
Defaults of CentOS Install not working with SELinux
Following a hard drive corruption I have reinstalled the latest version of CentOS and all current patch files. For most applications I selected the default options. By doing this I expected that the packages would play nice with one another and I could customize as necessary. Setting SELinux to enforce I encountered all sorts of problems - but most were resolvable, save for Dovecot,
2006 Nov 15
1
Quick survey for Speex 1.2
> /* FIXME: This VAD is a kludge */ > .. and it shows (or hears?) unfortunately. I've run a few tests with it > with my users, and they complain that it misdetects too often... In both > directions. Non-speech is detected as speech more often than before, and > more important it also doesn't detect speech as good as before. > I'd really like to see this
2008 Sep 01
3
[Bug 1519] New: zlib version check is fake in the configure script. installation failure.
https://bugzilla.mindrot.org/show_bug.cgi?id=1519 Summary: zlib version check is fake in the configure script. installation failure. Product: Portable OpenSSH Version: 5.1p1 Platform: ix86 OS/Version: Linux Status: NEW Severity: major Priority: P2 Component: Build system
2002 Oct 25
0
NeXT Community
I need someone in the NeXT community to apply this to 3.5 and tell me if it solves the mmap issue where it misdetects a working mmap(). My NeXT box is packed up. If you know anyone in Minnesota that wants a 68k-25mhz Slab w/ 2 B&W monitors, 2 keyboards, 2 mice, NeXT printer and OS. Have them email me. I won't ship it, but I have no more time to be handling an OS this old. =) I have no
2006 Nov 15
0
Quick survey for Speex 1.2
Jean-Marc Valin wrote: > Hi everyone, > > As you may have guess, Speex 1.2 is slowly approaching, though there's > still a lot left to do so I can't say how long it'll take. I thought > this was the right time to ask if there's anything missing or that can > be improved to make 1.2 better. At this point, it can't be anything > major, but there are still
2001 Nov 07
2
QNX
hello, How can i compile Ogg Tools on QNX and use them (Anyone have experience (Not XP)). I have allready tried but there isn't sys/shm.h so it stops there Thanx Tuukka Make a difference, help support the relief efforts in the U.S. http://clubs.lycos.com/live/events/september11.asp --- >8 ---- List archives: http://www.xiph.org/archives/ Ogg project homepage: http://www.xiph.org/ogg/
2004 Dec 08
3
wine-20041201 and iTunes
Hello, I've been trying to get iTunes working with wine-20041201 without much luck. I am trying this on a Fedora Core 2 machine on AMD64. The wine install seems to have gone ok, i can start notepad.exe etc without a problem. The only application that i will be using on wine will be iTunes(i use gtkpod, but it is isnt without its own quirks) and i cant seem to get it to work. I start an
2006 Nov 13
13
Quick survey for Speex 1.2
Hi everyone, As you may have guess, Speex 1.2 is slowly approaching, though there's still a lot left to do so I can't say how long it'll take. I thought this was the right time to ask if there's anything missing or that can be improved to make 1.2 better. At this point, it can't be anything major, but there are still some changes that are possible, e.g: - Improving some
2024 Aug 07
0
Processed: OCaml 5.2.0 uploaded to unstable
Processing commands for control at bugs.debian.org: > severity 1073913 serious Bug #1073913 [src:xen] FTBFS with OCaml 5.2.0 (Problem in C stubs) Severity set to 'serious' from 'important' > severity 1074548 serious Bug #1074548 [src:supermin] FTBFS with OCaml 5.2.0 (Uses Pervasives) Severity set to 'serious' from 'important' > severity 1077899 serious Bug
2012 Mar 22
1
Does libvirt check MCS labels during hot-add disk image ?
Libvirt doesn't care about security during hot add disk images. It even accepts addition of disk images of other guest running on the host. Steps followed to create this scenario : Started two VMs with following security configurations: vm1: <seclabel type='dynamic' model='selinux' relabel='yes'>
2003 Dec 01
0
No subject
Edit the file called src/EDITME and put the result in a file called Local/Makefile. Then you may proceed ... and next time ... you post an error message you may want to be specific ... not "or something like that" ... On Mon, 21 May 2001, Mager Charles WB wrote: > Again another email ALMOST off the point, but not quite. The first question, > which is to do with samba, is - How