similar to: Wine error: help

Displaying 20 results from an estimated 120 matches similar to: "Wine error: help"

2008 Jul 24
0
error again in poser 7
yesterday i can run poser in my hardy 64 , today i format the and try to run again the poser , the installation is fine ,but when i run give me this and initialize then turn off : gatito at gatito:~/.wine/drive_c/Archivos de programa/e frontier/Poser 7$ wine Poser.exe fixme:shell:DllCanUnloadNow stub fixme:shell:DllCanUnloadNow stub fixme:shell:DllCanUnloadNow stub fixme:shell:DllCanUnloadNow stub
2005 Jul 17
1
routing based on user id
Hi all! I''ve got 2 (soon 3) internet connection. 1 - via ADSL, 2(and3) via ppp My network: http://desima.objectis.net/network-diag linux1: user1.user2 eth0=192.168.1.1 ppp0=192.168.5.2( gw 192.168.5.1) gw=192.168.1.2 ( thru ADSL) compA=192.168.1.6 compB=192.168.1.15 gw2=192.168.1.217 via ppp to different ISP All works for compA and CompB, user1 should use default gw(192.168.1.2)
2007 Sep 29
1
Trying to run Diablo II MapHack
Hey people :) It's my first post/email here so please bear with me, I tried to reach wine-bugs through nabble and it said it was read-only so I'm posting it here... I'm actually very confused on what's the --main-- place where to get help with wine or report bugs or malfunctions or suggestions/improvements, so if anybody could guide me I would be very glad :). Anyways, I'm
2002 Nov 06
0
causality test
Dear list exist a function or package in R for Granger or Johanson causality test thanks in advance Rafael Gutierrez Estad?stico Unidad de Tecnolog?a Cerro Matoso S.A. Ext. 3350 "Este correo y sus anexos pueden ser confidenciales y estar protegidos por derechos de autor. Est?n dirigidos ?nica y exclusivamente para uso de el (los) destinatario(s). Si Usted por error lo ha recibido por
2007 Oct 22
1
Civ IV
Hello, I'm trying to get Civ IV running on my 64 bit version of Ubuntu 7.10 using the latest Wine version using these directions: http://tombuntu.com/index.php/2007/06/10/special-civilization-iv-playable-on-linux/ (the winehq appDB points to this guide as well) I'm having problems getting CivIV to run though. Firstly, looking at the wine settings here:
2007 Aug 20
0
Wine and Vmware Instrastructure Client
Hi I using wine and trying running Vmware Instrastructure Client, but I having some errors and this software VI Client does not running wine ../../.wine/drive_c/Program\ Files/VMware/VMware\ Virtual\ Infrastructure\ Client\ 2.0/vpxClient.exe fixme:virtual:NtAllocateVirtualMemory MEM_WRITE_WATCH type not supported fixme:virtual:NtAllocateVirtualMemory MEM_WRITE_WATCH type not supported
2012 Apr 09
1
Pairwise comparison matrix elements
Hi!, I'm really hoping someone out there will be able to help me. I recently started my MSc dissertation on Population Projection Matrices, which has been going well until now. I am trying to set-up a general script that does a pairwise comparison of all elements in my matrices. So for example, given that I have the following matrix S: > S [,1] [,2] [,3] [1,]
2007 Aug 04
1
CyberPower 1500AVR UPS configuration
Hola Estic fora de l?oficina des de Dimecres 1 d'Agost fins el proper Dilluns 12 d'Agost, Tan aviat sigui possible li contestar? el seu correu. En cas de ser un tema urgent, preguem reenvi? aquest mateix correu a l?adre?a d?email sst at salicru.com, els meus companys li donaran resposta el mes aviat possible, gr?cies. Hola Me encuentro fuera de la oficina del Miercoles 1 de Agosto
2003 Mar 28
0
openssh-unix-dev@mindrot.org , Swiss Group Switzerland ! Earn up to 2 daily in the Swish Stock Exchange !
<!1479> <html><body><p><b>Sw<!1479>iss Gro<!1479>up SA</b> is one of Switzerland's lead<!1479>ing pri<!1479>vate altern<!1479>ative inve<!1479>stment compa<!1479>nies which allocates its assets to a range of fu<!1479>nds mai<!1479>nly in the fi<!1479>eld of alter<!1479>native
2009 Jan 27
2
run perfect in v.0.9.56 but fail in v.1.1.13, help!!
Hi compa~eros, some one help me please, i use a voip software, its an special software for a service in D.R, i can run this perfect in v.0.9.56 but not in the V.1.-- :? this is the explanation program page: http://nuevositio.tricom.net/lineas+virtuales.aspx (in spanish) an the download link is: https://canales.tricom.net/lineasip/descargas.asp please help me, thanks
2005 May 09
0
Dell Powervault 132T tape library
Hello all. I'm struggling to get Centos 4 to recognize my Dell Powervaul 132T tape changer. The system doesnt create a device node for it. [root at orion scotty]# cat /proc/scsi/scsi Attached devices: Host: scsi0 Channel: 00 Id: 06 Lun: 00 Vendor: SEAGATE Model: DAT DAT72-052 Rev: A060 Type: Sequential-Access ANSI SCSI revision: 03 Host: scsi1 Channel: 00 Id: 01 Lun:
2001 Jul 25
0
Preserving groups
Sorry for the delayed response, I was on vacation. The answer is hinted to in the man page under -o: Note that if the source system is a daemon using chroot, the --numeric-ids option is implied because the source system cannot get access to the usernames. Actually, that says "source" and in your case it is the receiver, but I think perhaps if you use "use chroot =
2009 Feb 01
0
¡Ven y únete a Ingresos Reciduales toda tu vida!
Ingresos Reciduales toda tu vida: Ven inscribete y Obtendra el plan de obtener Los ingresos Residuales -------------------- Ven inscribete y aprendera como hacer dineros con ingresos reciduales haci creando una red que te genera dineros todos los meses. Ven y edifica tu familia con los ingresoso residuales. Haz clic en el v?nculo siguiente para participar:
2023 Jun 05
0
Auditoria de Recursos Humanos | INDS MÉXICO
Auditor?a y Control de RECURSOS HUMANOS 16 de junio | Online en Vivo RECURSOS HUMANOS es fundamental en la estructura de la compa?ia Este correo es una invitaci?n a toda aquella empresa interesada en conocer sobre la auditor?a y control de recursos humanos: Nuestro programa le proporcionara las herramientas necesarias para la correcta operaci?n de RH, con un buen control interno y aplicaci?n
2023 Jun 20
0
CONVOCATORIA
Buenos d?as, estamos convocando a todo el personal relacionado con el ?rea de compras para participar en el Congreso Nacional de Compras y Suministros para la Industria 2023-2024. Este evento dar? lugar en el Hotel Fiesta Americana de CDMX y est? orientado a discutir y ense?ar soluciones ?ptimas a las problem?ticas habituales en el departamento como la falta de transparencia, las demoras en las
2023 Jul 11
0
hola
Buenos d?as, estamos convocando a todo el personal relacionado con el ?rea de compras para participar en el Congreso Nacional de Compras y Suministros para la Industria 2023-2024. Este evento dar? lugar en el Hotel Fiesta Americana de CDMX y est? orientado a discutir y ense?ar soluciones ?ptimas a las problem?ticas habituales en el departamento como la falta de transparencia, las demoras en las
2023 Dec 11
0
pagame
Hola buen d?a. El motivo, es invitarles a participar en una conferencia Online este 19 de Diciembre que les ayudar? a eficientar sus procesos de cobranza con el fin de recuperar los financiamientos otorgados y cartera vencida. En caso de ser de su inter?s, perm?tame mandarle toda la informaci?n a usted para evaluar el temario y costos, y si es tan amable, me ayudar?a mucho si pudiera reenviarlo
2023 Dec 26
0
Reunion con usted
Hola buen d?a. Me sugirieron comunicarme con usted, con el motivo de invitarle a participar en este evento internacional sobre Alta Direcci?n para empresarios que ser? el 18 y 19 de Enero 2024 con sede en el Hotel Sheraton CDMX. Accionistas, due?os, socios y directores que deseen dominar la administraci?n profesional de las Empresas, tendr?n la oportunidad en este programa global para reflexionar
2009 Apr 23
1
Accessing all the first sub-elements of a list of list
Hello, The 179th and 180th elements of my list of lists look like this: [[179]] [[179]]$desc [1] ">ipi|IPI00646510|IPI00646510.2 ISOFORM P60-HCK OF TYROSINE-PROTEIN KINASE HCK." [[179]]$seq [1] "MGGRSSCEDPGCPRDEERAPRMGCMKSKFLQVGGNTFSKTETSASPHCPVYVPDPTSTIKPGPNSHNSNTP GIREAGSEDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVDSLETEE
2002 Oct 03
0
more on selective deletion
I am trying to arrange a mirroring of two trees which will be arranged like this : --- top --- .htaccess a --- a number of log files a +-- Files --- contains local stuff b +-- dir1 --- files c +-- dir2 --- files c |