similar to: I want to use a ram disk as / after network booting.

Displaying 20 results from an estimated 200 matches similar to: "I want to use a ram disk as / after network booting."

2005 Aug 26
1
i want to use ram disk image.
Hello I have a question. I am an engineer who is making communication systems. I have a board(made by Kontron ltd, Intel CPU, currently with diskless ) that is used in compactPCI. I boot that board with network PXELINUX method and currently using NFS. But I don't want to use NFS. NFS is only needed for getting kernel and initrd. I don't want to use NFS after booting and I want to make
2017 Aug 15
2
Is transport=rdma tested with "stripe"?
[ Hi Takao. Could you attach some logs which we can diagnostic? On 2017? 08? 15? 19:42, Hatazaki, Takao wrote: > > Hi, > > > > I did ib_write_lat in perftest. It worked fine. Between servers and > between server and client, 2-byte latency was ~0.8us, 8MB bandwidth > was ~6GB/s. Very normal with IB/FDR. > > > >
2017 Sep 21
0
Sharding option for distributed volumes
Hello Ji-Hyeon, Thanks, is that option available in 3.12 gluster release? because we're still on 3.8 and just playing around latest version in order to have our solution migrated. Thank you! 9/21/17 2:26 PM, Ji-Hyeon Gim ?????: > Hello Pavel! > > In my opinion, you need to check features.shard-block-size option first. > If a file nobigger than this value, it would not be
2017 Aug 06
0
State: Peer Rejected (Connected)
On 2017? 08? 06? 15:59, mabi wrote: > Hi, > > I have a 3 nodes replica (including arbiter) volume with GlusterFS > 3.8.11 and this night one of my nodes (node1) had an out of memory for > some unknown reason and as such the Linux OOM killer has killed the > glusterd and glusterfs process. I restarted the glusterd process but > now that node is in "Peer Rejected"
2017 Aug 06
1
State: Peer Rejected (Connected)
Hi Ji-Hyeon, Thanks to your help I could find out the problematic file. This would be the quota file of my volume it has a different checksum on node1 whereas node2 and arbiternode have the same checksum. This is expected as I had issues which my quota file and had to fix it manually with a script (more details on this mailing list in a previous post) and I only did that on node1. So what I now
2017 Nov 09
0
[Gluster-devel] Poor performance of block-store with RDMA
Hi Kalever! First of all, I really appreciate your test results for block-store(https://github.com/pkalever/iozone_results_gluster/tree/master/block-store) :-) My teammate and I tested block-store(glfs backstore with tcmu-runner) but we have met a problem of performance. We tested some cases with one server that has RDMA volume and one client that is connected to same RDMA network. two
2017 Aug 15
0
Is transport=rdma tested with "stripe"?
Hi, I did ib_write_lat in perftest. It worked fine. Between servers and between server and client, 2-byte latency was ~0.8us, 8MB bandwidth was ~6GB/s. Very normal with IB/FDR. -------------- next part -------------- An HTML attachment was scrubbed... URL: <http://lists.gluster.org/pipermail/gluster-users/attachments/20170815/4217c89e/attachment.html>
2011 Mar 17
1
can't boot isohybrid-ized image on CG2100
I have a isohybrid-ized image (isohybrid.pl from syslinux-4.03, no options passed) which works on several other systems, but can't boot a Kontron CG2100 from stick (same image boots fine from a portable CD-ROM drive though). The BIOS shows its initial splash, accesses the stick, then the system reboots - no errors logged in the BIOS event log. I tried disabling the "USB boot
2017 Aug 15
3
Is transport=rdma tested with "stripe"?
looks like your rdma is not functional did you tested with qperf? On Mon, Aug 14, 2017 at 7:37 PM, Hatazaki, Takao <takao.hatazaki at hpe.com> wrote: > Forgot to mention that I was using CentOS7.3 and GlusterFS 3.10.3 that is > the latest available. > > > > *From:* gluster-users-bounces at gluster.org [mailto:gluster-users-bounces@ > gluster.org] *On Behalf Of
2011 May 10
1
no kbd via serial
I had an isolinux config that was working with Kontron CG2100s for serial console with console redirection enabled in the BIOS (and attaching via SOL through an Intel RMM3 module) - for some reason I had to set serial port 1 instead of 0 in the config (even though the physical port is 0, and the RMM is supposed to just be redirecting the physical port), but it worked. A tester on a different
2017 Aug 06
2
State: Peer Rejected (Connected)
Hi, I have a 3 nodes replica (including arbiter) volume with GlusterFS 3.8.11 and this night one of my nodes (node1) had an out of memory for some unknown reason and as such the Linux OOM killer has killed the glusterd and glusterfs process. I restarted the glusterd process but now that node is in "Peer Rejected" state from the other nodes and from itself it rejects the two other nodes
2014 Oct 13
2
Re: passthrough of PCI-device
Hi Pierre, thanks for your reply. I am using kernel 3.10.0-123.8.1.el7.x86_64. The kernel modul used after nodedev-detach is vfio-pci This is the output of lspci -vv after I did a virsh nodedev-detatch pci_0000_02_00_0 02:00.0 Ethernet controller: PLX Technology, Inc. Device 235e Subsystem: PLX Technology, Inc. Device 235e Control: I/O- Mem- BusMaster- SpecCycle- MemWINV-
2014 Oct 13
2
Re: passthrough of PCI-device
Good morning, there is a typo in my description; the line <address domain='0x0' bus='0x1' slot='0x00' function='0x0'/> should be <address domain='0x0' bus='0x2' slot='0x00' function='0x0'/> That was correct in my xml-file. Isn't there anybody how can help me with that? Regards Michael Weis Von:
2008 Apr 29
10
any 64-bit mini-itx successes
Is there anyone who has successfully put together a "high-powered" mini-itx ZFS box that would be willing to post their system specs? I''m eyeballing the KI690-AM2... http://www.albatron.com.tw/english/product/mb/pro_detail.asp?rlink=Overview&no=239 ...but am having a difficult time locating it and a suitable case currently. I was in negotiations with a hardware source,
2004 Mar 30
1
Hot plug PCI?
The quick question: Do the digium drivers for the Digium Wildcard TE410P (4 port T1/E1/PRI 3.3v card) , the T100P (single port T1), and the TDM400P support hot plug PCI? I am also noting that while the TDM400P doesn't state the voltage requirements, it looks like a 5v card. I hope that I am wrong on this. What type of T1 channel bank would people recoment for ISDN (for video
2009 Apr 23
1
Accessing all the first sub-elements of a list of list
Hello, The 179th and 180th elements of my list of lists look like this: [[179]] [[179]]$desc [1] ">ipi|IPI00646510|IPI00646510.2 ISOFORM P60-HCK OF TYROSINE-PROTEIN KINASE HCK." [[179]]$seq [1] "MGGRSSCEDPGCPRDEERAPRMGCMKSKFLQVGGNTFSKTETSASPHCPVYVPDPTSTIKPGPNSHNSNTP GIREAGSEDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVDSLETEE
2013 Aug 13
5
Booting second label
Hi I'm using syslinux 5.01 and is installing our bootloader using "extlinux --install /boot". In the extlinux.conf I've specified that the kontron_wdt.c32 program should boot another label once it has been executed but it never calls the second label. Here's my extlinux.conf: default wdt timeout 5 prompt 1 label linuxfoo kernel /vmlinuz append root=/dev/sda2 #.... more
2005 Nov 07
0
rsync: readdir(.): Bad file descriptor (9)
Hi, I've spent the better part of three weeks tracking into this problem. I hope you don't mind a post here on smbfs, but I was hoping someone might have some insight or ideas on where to look next. Summary: trying to rsync folders across an smb mounted share with EXACTLY 50 objects (folder or files), results in the error rsync: readdir(.): Bad file descriptor (9) Details The problem
2015 Nov 18
2
Re: [PATCH] v2v: virtio-win: include *.dll too
+Li Jin ----- Original Message ----- > From: "Vadim Rozenfeld" <vrozenfe@redhat.com> > To: "Richard W.M. Jones" <rjones@redhat.com> > Cc: "Roman Kagan" <rkagan@virtuozzo.com>, libguestfs@redhat.com, "Amnon Ilan" <ailan@redhat.com>, "Jeff Nelson" > <jenelson@redhat.com>, "Yan Vugenfirer"
2013 Jun 23
1
2SLS / TSLS / SEM non-linear
Dear all, I try to conduct a SEM / two stage least squares regression with the following equations: First: X ~ IV1 + IV2 * Y Second: Y ~ a + b X therein, IV1 and IV2 are the two instruments I would like to use. the structure I would like to maintain as the model is derived from economic theory. My problem here is that I have trouble solving the equations to get the reduced form so I can run