similar to: i want to use ram disk image.

Hi I am an engineer who is making communication systems. I have a board(made by Kontron ltd, Intel CPU, currently with diskless ) that is used in compactPCI. I boot that board with network PXELINUX method and currently using NFS. But I don't want to use NFS and I want to make and use ram disk image. That means I want to use a ram disk as /. Currently I made a initrd by ltsp_initrd_kit. What

[ Hi Takao. Could you attach some logs which we can diagnostic? On 2017? 08? 15? 19:42, Hatazaki, Takao wrote: > > Hi, > > > > I did ib_write_lat in perftest. It worked fine. Between servers and > between server and client, 2-byte latency was ~0.8us, 8MB bandwidth > was ~6GB/s. Very normal with IB/FDR. > > > >

Hello Ji-Hyeon, Thanks, is that option available in 3.12 gluster release? because we're still on 3.8 and just playing around latest version in order to have our solution migrated. Thank you! 9/21/17 2:26 PM, Ji-Hyeon Gim ?????: > Hello Pavel! > > In my opinion, you need to check features.shard-block-size option first. > If a file nobigger than this value, it would not be

Hi Kalever! First of all, I really appreciate your test results for block-store(https://github.com/pkalever/iozone_results_gluster/tree/master/block-store) :-) My teammate and I tested block-store(glfs backstore with tcmu-runner) but we have met a problem of performance. We tested some cases with one server that has RDMA volume and one client that is connected to same RDMA network. two

On 2017? 08? 06? 15:59, mabi wrote: > Hi, > > I have a 3 nodes replica (including arbiter) volume with GlusterFS > 3.8.11 and this night one of my nodes (node1) had an out of memory for > some unknown reason and as such the Linux OOM killer has killed the > glusterd and glusterfs process. I restarted the glusterd process but > now that node is in "Peer Rejected"

Hi Ji-Hyeon, Thanks to your help I could find out the problematic file. This would be the quota file of my volume it has a different checksum on node1 whereas node2 and arbiternode have the same checksum. This is expected as I had issues which my quota file and had to fix it manually with a script (more details on this mailing list in a previous post) and I only did that on node1. So what I now

Hi, I did ib_write_lat in perftest. It worked fine. Between servers and between server and client, 2-byte latency was ~0.8us, 8MB bandwidth was ~6GB/s. Very normal with IB/FDR. -------------- next part -------------- An HTML attachment was scrubbed... URL: <http://lists.gluster.org/pipermail/gluster-users/attachments/20170815/4217c89e/attachment.html>

looks like your rdma is not functional did you tested with qperf? On Mon, Aug 14, 2017 at 7:37 PM, Hatazaki, Takao <takao.hatazaki at hpe.com> wrote: > Forgot to mention that I was using CentOS7.3 and GlusterFS 3.10.3 that is > the latest available. > > > > *From:* gluster-users-bounces at gluster.org [mailto:gluster-users-bounces@ > gluster.org] *On Behalf Of

Dear R-help, Hi I've got data table with variation and freqeuncy. I don't know how to get mean and sd. Please help me. Cheers. ========== variation frequency 0.503 79930 0.174 291140 -0.444 95916 -0.731 11451 0.453 102899 0.596 46133 -0.295 204859 0.013 390121 0.311 187552 -0.085 378902 -0.633 28164 0.175 291411 0.611 41903 0.318 183254 -0.661 22580 0.149 312574 0.594 46903 -0.557

Hi, I have a 3 nodes replica (including arbiter) volume with GlusterFS 3.8.11 and this night one of my nodes (node1) had an out of memory for some unknown reason and as such the Linux OOM killer has killed the glusterd and glusterfs process. I restarted the glusterd process but now that node is in "Peer Rejected" state from the other nodes and from itself it rejects the two other nodes

And what about IO MMU ? On 10/13/2014 12:02 PM, Weis, Michael (DWIE) wrote: > Hi Pierre, > > thanks for your reply. > > I am using kernel 3.10.0-123.8.1.el7.x86_64. > The kernel modul used after nodedev-detach is vfio-pci > > This is the output of lspci -vv after I did a virsh nodedev-detatch pci_0000_02_00_0 > > 02:00.0 Ethernet controller: PLX Technology, Inc.

Hi all, I setup the gluster filesystem and I want to mount the gluster volume using nfs in unix system. My machine is hp-ux (11.23) I put command like below but it has error test14:/>mount -F nfs -o proto=tcp,port=38465,vers=3,llock 150.2.226.26:/temp /mnt nfs mount: get_fh: 150.2.226.26:: RPC: Program not registered nfs mount: get_fh: 150.2.226.26:: RPC: Program not registered nfs mount:

Hi, I've spent the better part of three weeks tracking into this problem. I hope you don't mind a post here on smbfs, but I was hoping someone might have some insight or ideas on where to look next. Summary: trying to rsync folders across an smb mounted share with EXACTLY 50 objects (folder or files), results in the error rsync: readdir(.): Bad file descriptor (9) Details The problem

Hello, I try to passthrough a PCI-card to a VM named testvm I want to do that with an xml-file named hga.xml including the following content: <hostdev mode='subsystem' type='pci' managed='yes'> <source> <address domain='0x0' bus='0x1' slot='0x00' function='0x0'/> </source> </hostdev> When I execute

----- Original Message ----- > From: "Amnon Ilan" <ailan@redhat.com> > To: "Vadim Rozenfeld" <vrozenfe@redhat.com>, "Li Jin" <lijin@redhat.com> > Cc: "Richard W.M. Jones" <rjones@redhat.com>, "Roman Kagan" <rkagan@virtuozzo.com>, libguestfs@redhat.com, "Jeff > Nelson" <jenelson@redhat.com>,

Hello, The 179th and 180th elements of my list of lists look like this: [[179]] [[179]]$desc [1] ">ipi|IPI00646510|IPI00646510.2 ISOFORM P60-HCK OF TYROSINE-PROTEIN KINASE HCK." [[179]]$seq [1] "MGGRSSCEDPGCPRDEERAPRMGCMKSKFLQVGGNTFSKTETSASPHCPVYVPDPTSTIKPGPNSHNSNTP GIREAGSEDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVDSLETEE

Dear Michael, Did you activate the Intel IO MMU (or its equivalent for AMD)? Also, did you load the pci_stub module for Linux? It is mandatory (it will replace current driver for your passed through hardware). Cheers, Pierre On 10/13/2014 07:54 AM, Weis, Michael (DWIE) wrote: > Good morning, > > there is a typo in my description; > the line > <address

Hi Pierre, thanks for your reply. I am using kernel 3.10.0-123.8.1.el7.x86_64. The kernel modul used after nodedev-detach is vfio-pci This is the output of lspci -vv after I did a virsh nodedev-detatch pci_0000_02_00_0 02:00.0 Ethernet controller: PLX Technology, Inc. Device 235e Subsystem: PLX Technology, Inc. Device 235e Control: I/O- Mem- BusMaster- SpecCycle- MemWINV-

On Wed, Nov 18, 2015 at 11:31:17PM -0500, Li Jin wrote: > > > > In any case the *.inf files don't seem to have any distinguishing > > > > feature which would allow us to check this. > > > > > > > > Maybe this doesn't matter? > > > > > > Let me explain how it works: > > > We don't make any difference between

Good morning, there is a typo in my description; the line <address domain='0x0' bus='0x1' slot='0x00' function='0x0'/> should be <address domain='0x0' bus='0x2' slot='0x00' function='0x0'/> That was correct in my xml-file. Isn't there anybody how can help me with that? Regards Michael Weis Von: