Displaying 20 results from an estimated 700 matches similar to: "Cairo package failure to load backend"
2010 Apr 06
1
lattice package: line end style
First, apologies for no example data but I don't think it's needed in
this case,
Q: Can (and if so how ) the line end style be changed for 'cloud' plots?
I've tried par(lend=2), trellis.par.set(add.line = list(lend=2)) and
much googling but to no avail
Thanks in advance
Dan
P.S. the reason for this is that the round end looks bad at lwd=3 or
more
Daniel Alcock
Malaria
2009 Nov 17
1
strange read.table results
Hi I hope someone can shed some light on this:
For some reason when I
read.table("bfx.txt")
R decides to only give back the first character from each column in each row as one single column.
Like this:
V1
1 ÿþr
2 \n
3 r
4 1
5 0
6 A
7 G
8 \n
9 r
10 1
11 0
12 T
13 C
14 \n
The data should be:
2012 Mar 02
3
subseting a data frame
HI,
this is my problem I want to subset this file df, using only unique
df$exon printing the line once even if df$exon appear several times:
unique(df$exon) will show me the unique exons
If I try to print only the unique exon lines
with df[unique(df$exon),] -this doesn't print only the unique ones :(
could you help?
thanks
Nat
exon size chr start
2007 Nov 22
3
question about extreme value distribution
Hello,
I have a question about using extreme
value distribution in R.
I have two variables, X and Y, and have pairs
of points (X1,Y1),(X2,Y2), (X3,Y3) etc.
When I plot X against Y, it looks
like the maximum value of Y (for a particular X) is
correlated with X.
Indeed, when I bin the data by X-value into
equally sized bins, and test whether the maximum
value of Y for a bin is correlated with
2008 Aug 06
4
Font size in plots (I do NOT understand par help)
Hi,
I do not get how par works, help please.
Let's say I have a simple plot: plot(1:10)
I want to change the font size for the x axis... how do I do that?
Thank you,
Stephane
--
The Wellcome Trust Sanger Institute is operated by Genome Research
Limited, a charity registered in England with number 1021457 and a
compa
ny registered in England with number 2742969,
2007 Dec 19
1
FW: cgh package
Hi,
I would like some extra information on the 'cgh' package in R. I noticed
that there isn't much activity regarding this package on the R and BioC
mailing list (I googled it).
I started using this package and I have few questions:
1/ As I have a custom tiling like array @8um features resolution (affy),
I have a lot of probes to work with. I'm assuming it is correct to
2008 Jul 08
2
attributing values to dataframe positions following eval
Hi everybody,
I've been looking around, but can't seem to find the answer.
I get a list of names (which vary, so I never know them in advance), and
transform them into variables, each of which is a dataframe, using
assign:
polyList <- c("rs123", "rs124", "rs555", "rs000")
numPoly <- length(polyList)
for (k in 1:numPoly) {
2009 Apr 23
1
Accessing all the first sub-elements of a list of list
Hello,
The 179th and 180th elements of my list of lists look like this:
[[179]]
[[179]]$desc
[1] ">ipi|IPI00646510|IPI00646510.2 ISOFORM P60-HCK OF TYROSINE-PROTEIN
KINASE HCK."
[[179]]$seq
[1]
"MGGRSSCEDPGCPRDEERAPRMGCMKSKFLQVGGNTFSKTETSASPHCPVYVPDPTSTIKPGPNSHNSNTP
GIREAGSEDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVDSLETEE
2009 Jan 09
1
Calculating p-values from your own distribution as an array
Hi -
If I have a hypothetical distribution as an array
distribution<-c(0,1,2,3,4,5,6,7,8,9)
and I want to find the probability there is a value smaller than a new
value.
new_value<-4
(such that I'd get this type of output)
new_value p-value
4 0.5
3.4 0.4
3 0.4
0 0.1
-1 0.0
Thanks for the help, I bet this is really easy... :/
Stephen
--
The Wellcome Trust Sanger Institute is
2018 Jan 16
2
lost ability to apt-get install r-base=3.4.2-1trusty1
Hello,
I need a specific version of R installed for consistency reasons. I do the standard setup steps:
echo "deb https://cran.ma.imperial.ac.uk/bin/linux/ubuntu trusty/" | sudo tee -a /etc/apt/sources.list
sudo apt-key adv --keyserver keyserver.ubuntu.com --recv-keys E084DAB9
sudo apt-get update
And then a simple install call, which used to work just fine some time ago, tosses an
2010 Jun 21
1
need help when "make check" R-2.11.1
To whom it may concern:
My OS: CentOS 5.5
R version: R-2.11.1
My questions are as follows:
First, I inputted commands:
-----------------------------
# ./configure --enable-R-shlib
# make
# make check
-----------------------------
Everything goes well until "make check".
screen log:
**************************************
make[1]: Entering directory `/tmp/R-2.11.1/tests'
make[2]:
2011 Mar 08
2
positions and margins differ between X11 and SVG device
Hi,
I'm trying to get a plot ready for publication, which involves getting
it to look nice at a rather small size and to fine-tune positioning all
the labels and sizes of the margins.
I realise that I may not be doing this the right way and I welcome any
comments about better approaches to do this. What I have done so far is
open an X11 device with the size I want for the final output and I
2009 Jan 12
1
Determining variance components of classed covariates
Hi -
I am interested in solving variance components for the data below with
respect to the response variable, Expression within R.
However, the covariates aren't independent and they also have a class
(of which the total variance explained by covariates in that class I am
most interested in).
Very naively, I have tried to look at each individual covariates
variance like this
>
2004 May 27
2
Stats package
Hi
The cor function in the stats package calculates the correlation between
columns of data, does anyone know if it is at all possible to calculate
the correlation between rows instead ?
Or is there an appropriate package or function that is more appropriate
I'd like to calculate spearman & pearson correlations between rows.
Many thanks
Jason
--
--------------------------------
2013 Jul 26
3
Expunged message reappeared, giving a new UID
I am running dovecot 2.2.2 with tcp based replication, and experiencing
some duplicated emails. `doveconf -n` output is below.
I have narrowed it down to the following scenario:
An email arrives, and is successfully replicated to both nodes. It is in
INBOX/new/ at this point on both servers.
Connect with a mail client, and delete the message - without delayed
expunge. So, for example, mutt
2014 Mar 28
2
dsync replication questions
I am running two servers with Dovecot v2.2.12 on CentOS x86_64 (5.10 and
6.5 respectively) and users are virtual over ldap.
I have setup our main internal server (vmail.example.com) with dsync
replication according to the first part of
http://wiki2.dovecot.org/Replication. The second one
(vmail1.example.com) will be the failover server which we want to be a
real-time mirror (but can be
2009 Dec 14
0
Online help for text() wrong for 'pos' argument. (PR#14136)
Hello
Please find bug report attached.
Thanks
Matthew
--
Matthew Gillman
Team 105: Variation Informatics
Wellcome Trust Sanger Institute, Wellcome Trust Genome Campus, Hinxton, Cambridge, CB10 1SA, UK
Tel: 01223 834244 Ext. 4922
--
The Wellcome Trust Sanger Institute is operated by Genome Research
Limited, a charity registered in England with number 1021457 and a
company registered
2014 Dec 16
2
LDAP: Connection appears to be hanging, reconnecting
Hello List
I have a strange problem here which i try to analyse, but i'm stuck.
Maybe someone has a hint?
What happened:
A few weeks ago one of the LDAPS Servers which is not maintained by us
has crashed. From that moment on, users could still login to check their
emails, but they were not able to send any email through postfix (which
uses smtpd_sasl_type = dovecot)
What i do not
2009 Feb 19
2
read.table : how to condition on error while opening file?
Hi,
I'm using read.table in a loop, to read in multiple files. The problem
is that when a file is missing there is an error message and the loop is
broken; what I'd like to do is to test for the error and simply do
"next" instead of breaking the loop. Anybody knows how to do that?
Example:
filelist <- c("file1.txt", "file2.txt",
2018 Apr 08
1
How to script the script sample into script "OR", please advice
Dear User R
It's been a pleasure talking with you. I am newcomer use R. Would you
please help me how to translate the script below to "R" script?
* Area under receiver operating characteristic (AU-ROC)
predict r1m1p, p
roctab malaria r1m1p, graph summary
* Area under receiver operating characteristic (AU-ROC) curve
predict r1m2p, mu
roctab malaria r1m2p, graph summary