search for: rget

some of you might be interested. i just uploaded the first release of my r-excel interface package to CRAN. it is in contributed extensions nonstandard extensions erich neuwirth -- Erich Neuwirth, Computer Supported Didactics Working Group Visit our SunSITE at http://sunsite.univie.ac.at Phone: +43-1-4277-38624 Fax: +43-1-4277-9386

some of you might be interested. i just uploaded the first release of my r-excel interface package to CRAN. it is in contributed extensions nonstandard extensions erich neuwirth -- Erich Neuwirth, Computer Supported Didactics Working Group Visit our SunSITE at http://sunsite.univie.ac.at Phone: +43-1-4277-38624 Fax: +43-1-4277-9386

...ure --prefix=/Users/arnold/Desktop/testing/ vanilla-gcc-4.0/obj/../install --ena ble-llvm=/Users/arnold/Desktop/testing/vanilla-gcc-4.0/obj/../build -- with-arch=nocona --with-tune=generi c --with-gxx-include-dir=/usr/include/c++/4.0.0 --build=i686-apple- darwin8 --host=i686-apple-darwin8 --ta rget=i686-apple-darwin8 --enable-checking --program-prefix=llvm- -- with-gcc-version-trigger=/Users/arnold /Desktop/testing/vanilla-gcc-4.0/llvm-gcc-4.0/gcc/version.c --enable- languages=c,c++ ../llvm/configure --prefix=/Users/arnold/Desktop/ testing/vanilla-gcc-4.0/build/../local --enable-debug-runt...

...=BLOSUM62&NCBI_GI=on&PAGE=Proteins&PROGRAM=blastp&QUERY=MVCDKCEKKLSKVIVPDKWKDGARNVTEGGGRKINENKLLSKKNRWSPYSTCTTKCMICKQQVHQDGKYCHTCAYSKGVCAMCGKQVLDTKMYKQSNV&SERVICE=plain&SET_DEFAULTS.x=9&SET_DEFAULTS.y=5&SHOW_OVERVIEW=on&WORD_SIZE=3&END_OF_HTTPGET=Yes\" TARGET=\"_blank\">At1g61780</A> against nr\nUnformatted <A HREF=\"../cgi/getseq.pl?GabiMips+At1g61780+seq\" TARGET=\"_blank\">sequence string</A> for pasting into other applications\n\nFixed modifications: Carbamidomethyl (C)\nVariable modifications: Oxid...

...br> ChanVariable(SIP/1234-00000001): fu_callerid=3Dfoobar<br> <br> <br> --<br> Matthew Jordan<br> Digium, Inc. | Engineering Manager<br> 445 Jan Davis Drive NW - Huntsville, AL 35806 - USA<br> Check us out at: <a href=3D"http://digium.com" target=3D"_blank">http://dig= ium.com</a> &amp; <a href=3D"http://asterisk.org" target=3D"_blank">http://= asterisk.org</a><br> <br> <br> <br> --<br> _____________________________________________________________________&l...

kernel-headers-2.6.32-279.el6.x86_64.rpm<br> <br> Alec Davis<br> <br> <br> --<br> _____________________________________________________________________<br> -- Bandwidth and Colocation Provided by <a href=3D"http://www.api-digital.c= om" target=3D"_blank">http://www.api-digital.com</a> --<br> New to Asterisk? Join us for a live introductory webinar every Thurs:<br> =A0 =A0 =A0 =A0 =A0 =A0 =A0 =A0<a href=3D"http://www.asterisk.org/hello" ta= rget=3D"_blank">http://www.asterisk.org/he...

...;/div><div><br></div><d= iv><font face=3D"arial, sans-serif"><span style=3D"border-collapse:collapse= "><div> [root at localhost ~]# ping=A0<a href=3D"http://www.yahoo.com/" style=3D"color= :rgb(42, 93, 176)" target=3D"_blank">www.yahoo.com</a></div><div>PING=A0<a = href=3D"http://any-fp.wa1.b.yahoo.com/" style=3D"color:rgb(42, 93, 176)" ta= rget=3D"_blank">any-fp.wa1.b.yahoo.com</a>=A0(209.191.122.70) 56(84) bytes = of data.</div>...

...ing-left: 1ex;"> Mig= ht be worth seeing if other phones do the same.<br> <br> S<br> --<br> _____________________________________________________________________<br> -- Bandwidth and Colocation Provided by <a href=3D"http://www.api-digital.c= om" target=3D"_blank">http://www.api-digital.com</a> --<br> New to Asterisk? Join us for a live introductory webinar every Thurs:<br> =A0 =A0 =A0 =A0 =A0 =A0 =A0 <a href=3D"http://www.asterisk.org/hello" targ= et=3D"_blank">http://www.asterisk.org/hell...

...n succeeds, I am seeing a > notice to that effect on B. But if the registration *fails*, i'm not seeing > any message logged on B. Maybe I'm just not looking in the right place. Is > there a way to turn on logging or debugging so registration failures are > logged on the "target"? > > I'm doing something profoundly stupid, and seeing the notorious > > chan_sip.c:12009 handle_response_invite: Failed to authenticate on INVITE > > message, and trying to trace why. > > -Thanks, Jim > > -- > _____________________________________________...

...d/Desktop/testing/ > vanilla-gcc-4.0/obj/../install --ena > ble-llvm=/Users/arnold/Desktop/testing/vanilla-gcc-4.0/obj/../build -- > with-arch=nocona --with-tune=generi > c --with-gxx-include-dir=/usr/include/c++/4.0.0 --build=i686-apple- > darwin8 --host=i686-apple-darwin8 --ta > rget=i686-apple-darwin8 --enable-checking --program-prefix=llvm- -- > with-gcc-version-trigger=/Users/arnold > /Desktop/testing/vanilla-gcc-4.0/llvm-gcc-4.0/gcc/version.c --enable- > languages=c,c++ > > ../llvm/configure --prefix=/Users/arnold/Desktop/ > testing/vanilla-gcc-4.0/build/....

...r> <blockquote class=3D"gmail_quote" style=3D"margin: 0pt 0pt 0pt 0.8ex; borde= r-left: 1px solid rgb(204, 204, 204); padding-left: 1ex;">Hi, you can use f= ail2ban <a href=3D"http://www.voip-info.org/wiki/view/Fail2Ban+%28with+ipta= bles%29+And+Asterisk" target=3D"_blank">http://www.voip-info.org/wiki/view/= Fail2Ban+(with+iptables)+And+Asterisk</a><br> <br> Which works well, when a pattern is found in a log file it addes in an ipta= bles rules to block the traffic for a period.<br> <br> On debian you can apt-ge...

...t; John A. Sullivan III<br> Open Source Development Corporation<br> +1 207-985-7880<br> <a href=3D"mailto:jsullivan at opensourcedevel.com">jsullivan at opensourcedevel.= com</a><br> <br> <a href=3D"http://www.spiritualoutreach.com" target=3D"_blank">http://www.s= piritualoutreach.com</a><br> Making Christianity intelligible to secular society<br> <br> <br> _______________________________________________<br> -- Bandwidth and Colocation Provided by <a href=3D"http://www.api-digi...

...extern int smb_notify_change(struct dentry *dentry, struct iattr *attr); /* file.c */ @@ -81,10 +78,8 @@ extern int smb_init_request_cache(void); extern void smb_destroy_request_cache(void); extern struct smb_request *smb_alloc_request(struct smb_sb_info *server, int bufsize); -extern void smb_rget(struct smb_request *req); extern void smb_rput(struct smb_request *req); extern int smb_add_request(struct smb_request *req); -extern int smb_request_send_req(struct smb_request *req); extern int smb_request_send_server(struct smb_sb_info *server); extern int smb_request_recv(struct smb_sb_info...

...;<br>Regards<br><font color=3D"#888888">Sandesh<b= r> </font><br>--<br> _____________________________________________________________________<br> -- Bandwidth and Colocation Provided by <a href=3D"http://www.api-digital.c= om" target=3D"_blank">http://www.api-digital.com</a> --<br> New to Asterisk? Join us for a live introductory webinar every Thurs:<br> =A0 =A0 =A0 =A0 =A0 =A0 =A0 <a href=3D"http://www.asterisk.org/hello" targ= et=3D"_blank">http://www.asterisk.org/hell...

...ether<br> this would actually work, suggest alternatives?<br> <br> Many thanks.<br> <br> Brian<br> <br> _______________________________________________<br> -- Bandwidth and Colocation Provided by <a href=3D"http://www.api-digital.c= om" target=3D"_blank">http://www.api-digital.com</a> --<br> <br> asterisk-users mailing list<br> To UNSUBSCRIBE or update options visit:<br> =A0 <a href=3D"http://lists.digium.com/mailman/listinfo/asterisk-users" ta= rget=3D"_blank">http://...

.../raw/chkpath.c Compiling torture/raw/unlink.c Compiling torture/raw/read.c Compiling torture/raw/context.c Compiling torture/raw/write.c Compiling torture/raw/lock.c torture/raw/lock.c: In function ?test_zerobytelocks?: torture/raw/lock.c:1406: warning: assignment discards qualifiers from pointer target type torture/raw/lock.c:1410: warning: assignment discards qualifiers from pointer target type torture/raw/lock.c:1435: warning: assignment discards qualifiers from pointer ta rget type Compiling torture/raw/pingpong.c Compiling torture/raw/lockbench.c Compiling torture/raw/lookuprate.c Compiling t...

...t;/tr> </table> </body> </center> </html> <table width=3D'83' border=3D'0' cellspacing=3D'0' cellpadding=3D'0'><tr><t= d width=3D'83' height=3D'19'><a href=3D'http://www.buyflowersonline.com' ta= rget=3D'_blank'><img src=3D'http://www.free-website-counters.com/counter/st= yles/basic/1/users/16857/counter.jpg' border=3D'0' alt=3D'buy flowers'></a>= </td></tr><tr><td height=3D'13'><a href=3D'http://www.free-websi...

...ww.openmp.org/mp-documents/openmp-4. > 5.pdf > > 2. VectorABI Documentation: > https://www.cilkplus.org/sites/default/files/open_specifications/Intel > -ABI-Vecto > r-Function-2012-v0.9.5.pdf > https://sourceware.org/glibc/wiki/libmvec?action=AttachFile&do=view&ta > rget=Vecto > rABI.txt > > [[Note: VectorABI was reviewed at X86-64 System V Application Binary Interface > mailing list. The discussion was recorded at > https://groups.google.com/forum/#!topic/x86-64-abi/LmppCfN1rZ4 > ]] > > 3. The first paper on SIMD extensions...

...efined reference to `safe_strcpy_fn' modules/vfs_cap.po: In function `capdecode': modules/vfs_cap.po(.text+0xfdc): undefined reference to `safe_strcpy_fn' Compiling modules/vfs_expand_msdfs.c with -fPIC Building plugin bin/expand_msdfs.so modules/vfs_expand_msdfs.po: In function `read_target_host': modules/vfs_expand_msdfs.po(.text+0x34): undefined reference to `x_fopen' modules/vfs_expand_msdfs.po(.text+0x4d): undefined reference to `DEBUGLEVEL_CLASS' modules/vfs_expand_msdfs.po(.text+0x5b): undefined reference to `DEBUGLEVEL_CLASS_ISSET' modules/vfs_expand_msdfs.po(...

...&gt; =A0 =A0 =A0 =A0 --<br> &gt; =A0 =A0 =A0 =A0 ______________________________________________________= _______________<br> &gt; =A0 =A0 =A0 =A0 -- Bandwidth and Colocation Provided by<br> &gt; =A0 =A0 =A0 =A0 <a href=3D"http://www.api-digital.com" target=3D"_blan= k">http://www.api-digital.com</a> --<br> &gt; =A0 =A0 =A0 =A0 New to Asterisk? Join us for a live introductory webin= ar every<br> &gt; =A0 =A0 =A0 =A0 Thurs:<br> &gt; =A0 =A0 =A0 =A0 =A0 =A0 =A0 =A0 =A0 =A0 =A0 <a href=3D"http://ww...