search for: hck

Hello, The 179th and 180th elements of my list of lists look like this: [[179]] [[179]]$desc [1] ">ipi|IPI00646510|IPI00646510.2 ISOFORM P60-HCK OF TYROSINE-PROTEIN KINASE HCK." [[179]]$seq [1] "MGGRSSCEDPGCPRDEERAPRMGCMKSKFLQVGGNTFSKTETSASPHCPVYVPDPTSTIKPGPNSHNSNTP GIREAGSEDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVDSLETEE WFFKGISRKDAERQLLAPGNMLGSFMIRDSETTKGSYSLSVRDYDPRQGDTVKHYKIRTLDNGGFYISPRST FSTLQELVDHYKKGND...

..._uint8(mdp, &tb); error = md_get_uint16le(mdp, &rqp->sr_serror); if (!error) rperror = smb_maperror(rqp->sr_errclass, rqp->sr_serror); I'm working through the netsmb source code, but it's slow going. I ran the above example on # uname -a FreeBSD 30.dhcp.hck.carroll.com 4.11-STABLE FreeBSD 4.11-STABLE #1: Tue Nov 1 22:15:50 EST 2005 jim@30.dhcp.hck.carroll.com:/usr/src/sys/compile/NC.DEBUG i386 We also ran it on a Darwin machine $ uname -a Darwin 94.dhcp.hck.carroll.com 7.9.0 Darwin Kernel Version 7.9.0: Wed Mar 30 20:11:17 PST 2005; root:xnu/xnu-5...

+Li Jin ----- Original Message ----- > From: "Vadim Rozenfeld" <vrozenfe@redhat.com> > To: "Richard W.M. Jones" <rjones@redhat.com> > Cc: "Roman Kagan" <rkagan@virtuozzo.com>, libguestfs@redhat.com, "Amnon Ilan" <ailan@redhat.com>, "Jeff Nelson" > <jenelson@redhat.com>, "Yan Vugenfirer"

Dear all, I try to conduct a SEM / two stage least squares regression with the following equations: First: X ~ IV1 + IV2 * Y Second: Y ~ a + b X therein, IV1 and IV2 are the two instruments I would like to use. the structure I would like to maintain as the model is derived from economic theory. My problem here is that I have trouble solving the equations to get the reduced form so I can run

Dear all Problem: hist()-function, scale = ?percent? I want to generate histograms for changing underlying data. In order to make them comparable, I want to fix the y-axis (vertical-axis) to, e.g., 0%, 10%, 20%, 30% as well as to fix the spaces, too. So the y-axis in each histogram should be identical. Currently, I have 100 histograms and the y-axis scales changes in each. Here is my code:

...extra warning). The original *.cat file is same,whether the *.cat files are still same afer whql submission depends on whether they are submit in one submission. for example: win8-64 and win2012 *.cat files are same because QE submit them in one submission(win8-64 and win2012 whql test both run on hck,results can be merged into one package); win7-64 and win2008-64 *.cat files are different because we submit them in different submissions(win7-64 whql test run on hck,win2008-64 run wlk,hck and wlk must submit differently according to msft's strategy). I tried swap cat files,drivers still can...

...on't want to use NFS and I want to make and use ram disk image. That means I want to use a ram disk as /. Currently I made a initrd by ltsp_initrd_kit. What should I have to change in 'linuxrc' file and pxelinux.cfg/default file. And how can I make ram disk image. Thanks in advance. HCK. ================================================ Hyeon Cheol Kim Netss Co., Ltd 504 Anyang Technical College Venture Center 572-5. Anyang-Dong, Manan-Gu, Anyang-City, Gyeonggi-Do, Korea, 430-731 Tel: 82-31-464-9070 82-19-397-1547 Fax: 82-31-464-8983 E-mail: hckimm2 at netss.co.kr...

...e fix myself, and let you see how it goes, but I''m aware that there are probably subtleties that I haven''t grasped yet e.g. I shouldn''t be testing explicitly for LI and UL tags, because the tag types can be overridden in the options array (line 427). I''ll have a hck at it - in the meantime, if anyone has experience with solving this issue, I''d be grateful to hear from you. Cheers, Dave Crane Author ''Ajax in Action'' http://dave.sunwheeltech.com/wordpress/

...> The original *.cat file is same,whether the *.cat files are still same afer whql submission depends on whether they are submit in one submission. > for example: > win8-64 and win2012 *.cat files are same because QE submit them in one submission(win8-64 and win2012 whql test both run on hck,results can be merged into one package); > win7-64 and win2008-64 *.cat files are different because we submit them in different submissions(win7-64 whql test run on hck,win2008-64 run wlk,hck and wlk must submit differently according to msft's strategy). > > I tried swap cat files,dri...

...9;t want to use NFS. NFS is only needed for getting kernel and initrd. I don't want to use NFS after booting and I want to make and use ram disk image. What should I have to change in 'linuxrc' file and pxelinux.cfg/default file. And how can I make ram disk image. Thanks in advance. HCK. ================================================ Hyeon Cheol Kim Netss Co., Ltd 504 Anyang Technical College Venture Center 572-5. Anyang-Dong, Manan-Gu, Anyang-City, Gyeonggi-Do, Korea, 430-731 Tel: 82-31-464-9070 82-19-397-1547 Fax: 82-31-464-8983 E-mail: hckimm2 at netss.co.kr...

...ice to have this in! > >Thomas > >Am 18.07.2005 um 13:20 schrieb dave crane: > >> I set up two lists so that I can drag items between them, then if >> either list >> becomes empty, I can''t drag elements back into it. >> >> I''ll have a hck at it - in the meantime, if anyone has experience >> with solving >> this issue, I''d be grateful to hear from you. >-- >This email has been verified as Virus free >Virus Protection and more available at http://www.plus.net

Hallo everybody, I'm wondering whether it might be possible to speed up the following code: Error<-rnorm(10000000, mean=0, sd=0.05) estimate<-(log(1.1)-Error) DCF_korrigiert<-(1/(exp(1/(exp(0.5*(-estimate)^2/(0.05^2))*sqrt(2*pi/(0.05^2))*(1-pnorm(0,((-estimate)/(0.05^2)),sqrt(1/(0.05^2))))))-1)) D<-100000 Delta_ln<-rep(0,D) for(i in 1:D)

...xr~SX615GMOa>Sd}eygwBm3u~uyB;>!FNix|7#x`$ zHDuB4tsBwlf!y(Cs!Fw^W0qXfbZFkon7avgle3#55@*;uq?G*8G3SlxU;L7r{D(5Q z5iK%0y)GP5aWkT0q<#BhKjKT{f{P==_pa)8zG7DM*xdADWi|jYucyXHq2*ln+Ja at n zPe%6sef^;cTQ1y=Jd)V413)i at IOGwr{n+Uo+uDo4Pp3?owR-iwIWfy#Z}_z`J at WXb zycLGUKpF^$d7hPek)KGvW^$mvRXXk4DWj%Gev|HcKIYAbLkE5~&f}+mKcx`^kG}aH zSXTl>UwyhM^Y=gzd3N!~Ya8RYEtoP(zk2uQzefM``c`Sg7Qqa>A9SLTRJ}SkrRiYg z$OCnos;-WIx~%VGT_4*=gF7BQ4%5#{W*wLu+5OzE>n~Lw&Hdb9-#%EsxZmx_FG8gA zVS1VnHFERUt_1_)COlj|X`OXI^nAhjmnC=B&mG`nh9%Z5P>t%4?%kftMz$zDd(Y3` z{q{}OQ}5ByZcks_yy8)*bJ=hI at XDd^QQ?zE)PVMJ+fey&a...