Displaying 2 results from an estimated 2 matches for "getseq".
Did you mean:
getse
2011 Apr 16
3
calling dovecot exported auth from Java
As far as I have been able to figure out, dovecot auth always works over
a Unix domain socket. I believe it is not currently possible to operate
dovecot auth over an Internet domain (TCP) socket. Am I correct?
I want to call dovecot's exported authentication from a Java
application. Java doesn't natively know how to talk to a Unix domain
socket, so there are inconveniences. There
2004 Feb 19
1
Process R segmentation with strsplit() (PR#6601)
...TEGGGRKINENKLLSKKNRWSPYSTCTTKCMICKQQVHQDGKYCHTCAYSKGVCAMCGKQVLDTKMYKQSNV&SERVICE=plain&SET_DEFAULTS.x=9&SET_DEFAULTS.y=5&SHOW_OVERVIEW=on&WORD_SIZE=3&END_OF_HTTPGET=Yes\" TARGET=\"_blank\">At1g61780</A> against nr\nUnformatted <A HREF=\"../cgi/getseq.pl?GabiMips+At1g61780+seq\" TARGET=\"_blank\">sequence string</A> for pasting into other applications\n\nFixed modifications: Carbamidomethyl (C)\nVariable modifications: Oxidation (M)\nCleavage by Trypsin: cuts C-term side of KR unless next residue is P\nNumber of mass valu...