search for: compae

Hi! I'm having the following problem with samba 1.9.18 running on Linux 2.0.32: I can't map drives using MS Client 3.0 for Dos. I get "Invalid password for share (Error 86) from client when trying to map drives. --- smb.conf --------------------------------------------------- [global] domain logons = no dns proxy = no getwd cache = yes guest account = guest hosts allow =

hello, i have a problem with wine, but i don't know the meaning of the message that it replays when i try to start the prog .exe. This is the message: Code: ... wine: Unhandled page fault on read access to 0xd12e3930 at address 0x41654d (thread 0009), starting debugger... Unhandled exception: page fault on read access to 0xd12e3930 in 32-bit code (0x0041654d).

Hi all! I''ve got 2 (soon 3) internet connection. 1 - via ADSL, 2(and3) via ppp My network: http://desima.objectis.net/network-diag linux1: user1.user2 eth0=192.168.1.1 ppp0=192.168.5.2( gw 192.168.5.1) gw=192.168.1.2 ( thru ADSL) compA=192.168.1.6 compB=192.168.1.15 gw2=192.168.1.217 via ppp to different ISP All works for compA and CompB, user1 should use default gw(192.168.1.2)

samba@samba.org Serge Gavrilov <serge@pdmi.ras.ru> Ed Schernau <ed@schernau.com> Jeremy Allison <jeremy@valinux.com> Cristian POP <cpop@compas.dntcj.ro> Ed Schernau <ed@schernau.com> John Evans <samba@kilnar.com> David Bullock <davidb@loftuscomp.com.au> Gunnar Lindholm <gunnar.lindholm.320@student.lu.se> Junaid Iqbal

Hi!, I'm really hoping someone out there will be able to help me. I recently started my MSc dissertation on Population Projection Matrices, which has been going well until now. I am trying to set-up a general script that does a pairwise comparison of all elements in my matrices. So for example, given that I have the following matrix S: > S [,1] [,2] [,3] [1,]

Hello, I already download rm160.sit to a iMac9.1 computer. But I can not run R-icon for installation of R. The computer told me --the application "R" could not be opend because "Carbonlib" could not be found. I donot know why I could not install R to the computer. Thank you. Jinbo __________________________________________________ Faith Hill - Exclusive Performances,

Hi, I do not get how par works, help please. Let's say I have a simple plot: plot(1:10) I want to change the font size for the x axis... how do I do that? Thank you, Stephane -- The Wellcome Trust Sanger Institute is operated by Genome Research Limited, a charity registered in England with number 1021457 and a compa ny registered in England with number 2742969,

Dear R-Help i have a newbie question, how edit size fonts and colors in the plots (scatter.acm or dudi.acm function) of multiple correspondence analysis in the ADE4 Package? thanks? Rafael Gutierrez Estad??stico Unidad de Tecnolog??a Cerro Matoso S.A. Tel. 4-7723350 Fax. 4-7723236 ************************************************************************************************* Este correo

Hi, I need a script which makes the package compa??o rpm's through two text files ... Since a file is the output of the command *rpm-qa > pkg.out * And the second file is a list of several packages rpm's, multiple versions and architectures. My idea is to compare a package *x* file pkg.out with several packages *y* of the file update.out and know

Hi, I am using the LLVM JIT infrastructure (MCJIT). I wanted to see if there are any performance gains as the compiler can detect the target CPU at runtime. But, I didn't see any improvement (I compile with -no-mmx and -no-sse). I then tried an experiment, where I compiled the program with clang-3.3, with and without specifying the target cpu as "corei7". I was shocked to see that

Hi compa~eros, some one help me please, i use a voip software, its an special software for a service in D.R, i can run this perfect in v.0.9.56 but not in the V.1.-- :? this is the explanation program page: http://nuevositio.tricom.net/lineas+virtuales.aspx (in spanish) an the download link is: https://canales.tricom.net/lineasip/descargas.asp please help me, thanks

Hello, The 179th and 180th elements of my list of lists look like this: [[179]] [[179]]$desc [1] ">ipi|IPI00646510|IPI00646510.2 ISOFORM P60-HCK OF TYROSINE-PROTEIN KINASE HCK." [[179]]$seq [1] "MGGRSSCEDPGCPRDEERAPRMGCMKSKFLQVGGNTFSKTETSASPHCPVYVPDPTSTIKPGPNSHNSNTP GIREAGSEDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVDSLETEE

Hi everybody, I've been looking around, but can't seem to find the answer. I get a list of names (which vary, so I never know them in advance), and transform them into variables, each of which is a dataframe, using assign: polyList <- c("rs123", "rs124", "rs555", "rs000") numPoly <- length(polyList) for (k in 1:numPoly) {

Hi all, I am working wit a Mandriva 2007 and have installed the asterisk svn 1.4 with success. I also used the patch for cellphones and it works perfectly. I was that happy that I decided to buy a TDM11B and it works. Now, I want to study a bit the code used by this people. Does anybody know how can I go deeper in this code with funcitonal bloqs in order to understand how is possible to

Dear list exist a function or package in R for Granger or Johanson causality test thanks in advance Rafael Gutierrez Estad?stico Unidad de Tecnolog?a Cerro Matoso S.A. Ext. 3350 "Este correo y sus anexos pueden ser confidenciales y estar protegidos por derechos de autor. Est?n dirigidos ?nica y exclusivamente para uso de el (los) destinatario(s). Si Usted por error lo ha recibido por

Dear R experts, Did someone implemented French Curve yet? Or can anyone point me some papers that I can follow to implement it? thanks in advance for your help. Paul

Saludo estimados compañeros y compañeras Tengo una matriz de datos de 51 filas por 160 columnas, Cada columna es una serie de tiempo. Existe alguna libreria q me calcule la posicion de la fila donde se hallan estos maximos y minimos o los eventos de estas curvas Agradezco la atencion CARLOS ANDRES [[alternative HTML version deleted]]

Hi Varun, Have you tried your experiment with icc by any chance? The MCJIT component does not assume that you will be executing the generated code on the host system because it can be used to generate code for external targets. However, you can specify the CPU by calling setCPU() on the EngineBuilder object before creating your execution engine. (You can use sys::getHostCPUName() to figure out

Hi Andrew, I think I diluted my question. My question was not related to MCJIT. I ran the following 4 scenarios: (1)gcc -mcpu=corei7 tetris.c -o tetris (2)gcc -mcpu=athlon64 tetris.c -o tetris (3)clang -march=corei7 tetris.c -o tetris (4)clang -march=athlon64 tetris.c -o tetris In (1) and (2), I see difference in order of instructions in the output binaries, which I expected because every CPU

Por cierto data.table tiene implementadas las funciones de reshape2 melt y dcast pero mucho m?s r?pidasen ejecuci?n Obtener Outlook para Android<https://aka.ms/ghei36> ________________________________ From: R-help-es <r-help-es-bounces en r-project.org> on behalf of V?ctor Granda Garc?a <victorgrandagarcia en gmail.com> Sent: Monday, June 25, 2018 4:23:52 PM To: Fernando Reche