search for: 180th

Displaying 1 result from an estimated 1 matches for "180th".

Did you mean: 10th
2009 Apr 23
1
Accessing all the first sub-elements of a list of list
Hello, The 179th and 180th elements of my list of lists look like this: [[179]] [[179]]$desc [1] ">ipi|IPI00646510|IPI00646510.2 ISOFORM P60-HCK OF TYROSINE-PROTEIN KINASE HCK." [[179]]$seq [1] "MGGRSSCEDPGCPRDEERAPRMGCMKSKFLQVGGNTFSKTETSASPHCPVYVPDPTSTIKPGPNSHNSNTP GIREAGSEDIIVVALYDYEAIHHEDLSFQK...