search for: 179th

Hello, The 179th and 180th elements of my list of lists look like this: [[179]] [[179]]$desc [1] ">ipi|IPI00646510|IPI00646510.2 ISOFORM P60-HCK OF TYROSINE-PROTEIN KINASE HCK." [[179]]$seq [1] "MGGRSSCEDPGCPRDEERAPRMGCMKSKFLQVGGNTFSKTETSASPHCPVYVPDPTSTIKPGPNSHNSNTP GIREAGSEDIIVVALYDYEA...

...but in this particular instance it makes sense. I'm using CentOS 5 and bind 9.9.3. Thanks! Also, do caching web proxies like Squid still speed up the web experience over a slow link what with all of the dynamic content on the web these days? Ben Weiss -- BENJAMIN J WEISS CPT, SC 1st BN 179th INFANTRY S6, Base Defense, Camp Bucca, Iraq "Always Ready!"