search for: 179

Displaying 20 results from an estimated 1258 matches for "179".

Did you mean: 17
2010 May 07
1
writing string values from a matrix to a file without enclosing quotes
...000" to a plain ascii file without surrounding the numerals with quotes, the original data is in a matrix formatted paired strings, and written to file using write.table(x,"output filename",col.names=F,row.names=F) thus "77 79" "132 132" "000 000" "179 181" "132 132" "150 150" "179 179" "132 132" "000 000" "179 179" "132 134" "150 152" however I need the output file without the quotes but retaining 000 not reducing it to 0 thus 77 79 132 132 000 000 179 181 13...
2008 Feb 12
4
summary statistics
...7600000 16 198 0.4800000 17 hc 3.1818182 18 hc 3.7254902 19 hc 4.3750000 20 hc 2.6415094 21 190 0.3500000 22 190 0.4400000 23 190 0.6500000 24 190 0.5000000 25 bc 9.0000000 26 bc 5.0000000 27 bc 4.0000000 28 bc 3.2000000 29 185 0.7386364 30 185 0.5000000 31 185 1.1538462 32 185 0.6000000 33 179 1.8181818 34 179 1.1980000 35 179 2.5000000 36 179 2.0000000 37 148 2.0833333 38 148 2.3333333 39 148 3.1000000 40 148 2.2142857 41 119 2.4444444 42 119 2.3275862 43 119 4.7142857 44 119 1.7692308 45 61 2.8888889 46 61 3.2500000 47 61 4.7500000 48 61 2.6337449 -- Let's not spend our time...
2008 Nov 20
2
Removing rows with rowsums==0 (I can't figure this out)
...119 2007/10", "119 2008/01", "148 2006/05", "148 2006/10", "148 2006/12", "148 2007/02", "148 2007/04", "148 2007/06", "148 2007/08", "148 2007/10", "148 2007/12", "148 2008/01", "179 2006/04", "179 2006/05", "179 2006/10", "179 2006/12", "179 2007/02", "179 2007/04", "179 2007/06", "179 2007/08", "179 2007/10", "179 2007/12", "179 2008/01", "185 2006/04", "185...
2004 Dec 09
6
Cisco AS5XXX to asterisk debugging.
...xx ----> ASterisk---->PSTN(B) (No Nat, no Firewall) I hear (on the PSTN(A)) clearly what the other person is saying, but the other person (on the PSTN(B) side) hears nothing from PSTN(A). I use tcpdump for debug de rtp trafic, and ouput contains 19:06:00.741293 IP (tos 0x0, ttl 64, id 179, offset 0, flags [DF], proto 17, length: 60) x.x.x.x.19926 > y.y.y.y.18974: [no cksum] UDP, length 32 19:06:00.763133 IP (tos 0x0, ttl 64, id 179, offset 0, flags [DF], proto 17, length: 60) x.x.x.x.19926 > y.y.y.y.18974: [no cksum] UDP, length 32 19:06:00.740415 IP (tos 0x0, ttl 64, id 179...
2006 Apr 06
12
net drive mapping not working in login script
I've set the path for each user in pdbedit and created a login script with drive mapping etc etc The network drives aren't being mapped when I login each user: smb.conf [global] printcap name = cups cups options = raw map to guest = Bad User # include = /etc/samba/dhcp.conf logon path = \\%L\profiles\.msprofile logon home = \\%L\%U\.9xprofile
2002 Mar 22
3
[Bug 179] sshd sends channel data after sending EOF
http://bugzilla.mindrot.org/show_bug.cgi?id=179 markus at openbsd.org changed: What |Removed |Added ---------------------------------------------------------------------------- Status|NEW |ASSIGNED ------- Additional Comments From markus at openbsd.org 2002-03-22 22:37...
2009 Apr 23
1
Accessing all the first sub-elements of a list of list
Hello, The 179th and 180th elements of my list of lists look like this: [[179]] [[179]]$desc [1] ">ipi|IPI00646510|IPI00646510.2 ISOFORM P60-HCK OF TYROSINE-PROTEIN KINASE HCK." [[179]]$seq [1] "MGGRSSCEDPGCPRDEERAPRMGCMKSKFLQVGGNTFSKTETSASPHCPVYVPDPTSTIKPGPNSHNSNTP GIREAGSEDIIVVALYDY...
2001 Aug 20
3
(No)DGA
...error message: bash-2.04# wine "/windows/E/Programme/CyberLink/PowerDVD/powerdvd.exe" X Error of failed request: XF86DGANoDirectVideoMode Major opcode of failed request: 136 (XFree86-DGA) Minor opcode of failed request: 22 (XDGAOpenFramebuffer) Serial number of failed request: 179 Current serial number in output stream: 179 bash-2.04# Does anyone here know a way to fix this? What did I do wrong? Many thanks in regard Florian Idelberger
2008 Nov 20
2
Calculating SD according to groups of rows
...7200 158 2 7200 165 3 7200 138 4 7200 152 5 7200 139 6 7200 157 7 7200 186 8 23955 167 9 23955 162 10 23955 171 11 23955 139 12 23955 170 13 23955 177 14 23955 180 15 23955 176 16 23955 172 17 23955 179 18 23955 181 19 23955 169 20 23955 168 21 23955 185 22 23955 181 23 23955 191 24 23955 179 25 23955 178 26 23955 184 27 23955 179 28 23955 172 29 23955 173 30 23955 182 31 23955 174 * So, what I would want is a table of 800 pati...
2008 May 30
3
v1.1.rc6 released won't compile
...pes -Wmissing-declarations -Wpointer-arith -Wchar-subscripts -Wformat=2 -Wbad-function-cast -Wstrict-aliasing=2 -MT mail-index-write.o -MD -MP -MF .deps/mail-index-write.Tpo -c -o mail-index-write.o mail-index-write.c mail-index-write.c: In function 'mail_index_write': mail-index-write.c:179: error: 'struct stat' has no member named 'st_ctim' mail-index-write.c:179: error: 'struct stat' has no member named 'st_ctim' *** Error code 1 Stop in /opt1/source/dovecot-1.1.rc6/src/lib-index. *** Error code 1 Stop in /opt1/source/dovecot-1.1.rc6/src. *** Error...
2020 Mar 18
2
[GSOC] "Project: Improve inter-procedural analyses and optimisations"
On 03/16, Fahad Nayyar wrote: > I can see that Johanned have put up some issues for GSOC aspirants. I think > that [2] <https://github.com/llvm/llvm-project/issues/179> ([Attributor] > Cleanup and upstream `Attribute::MaxObjectSize`) will be a very good issue > for me, It seems doable and I can get familiar with the whole process of > writing a patch for an issue. How should I indicate to the community that I > have started working towards this iss...
2008 Nov 04
1
ggplot2 scatterplot matrix
...L, 3L, 3L, 3L, 3L, 4L, 4L, 4L, 4L, 4L, 4L, 5L, 5L, 5L, 5L, 5L, 5L, 6L, 6L, 6L, 6L, 6L, 6L, 7L, 7L, 7L, 7L, 7L, 7L, 8L, 8L, 8L, 8L, 8L, 8L, 9L, 9L, 9L, 9L, 9L, 9L, 10L, 10L, 10L, 10L, 10L, 10L, 11L, 11L, 11L, 11L, 11L, 11L, 12L, 12L, 12L, 12L, 12L), .Label = c("119", "148", "179", "185", "190", "198", "202", "215", "61", "BC", "HC", "SC"), class = "factor"), Date = structure(c(1L, 2L, 3L, 4L, 5L, 6L, 1L, 2L, 3L, 4L, 5L, 6L, 1L, 2L, 3L, 4L, 5L, 6L, 1L, 2L, 3L, 4L...
2016 May 09
0
New Xen-44 update for XSA-179
There are new Xen-44 packages for XSA-179 in the testing repo based on xen-4.4.4-4.el6.src.rpm If you are using the xen-44 branch, please test and report issues to this list. Thanks, Johnny Hughes -------------- next part -------------- A non-text attachment was scrubbed... Name: signature.asc Type: application/pgp-signature Size: 198 b...
2016 May 09
0
New Xen-46 updates for XSA-179 for EL6 and EL7
There are new Xen-46 packages for XSA-179 in the testing repo based on xen-4.6.1-7.el6.src.rpm (for EL6) and xen-4.6.1-7.el7.src.rpm (for EL&). If you are using the xen-46 branch on either el6 ot el7, please test and report issues to this list. Thanks, Johnny Hughes -------------- next part -------------- A non-text attachment was...
2020 Jan 15
0
CentOS-announce Digest, Vol 179, Issue 1
...CentOS ------------------------------ Subject: Digest Footer _______________________________________________ CentOS-announce mailing list CentOS-announce at centos.org https://lists.centos.org/mailman/listinfo/centos-announce ------------------------------ End of CentOS-announce Digest, Vol 179, Issue 1 ***********************************************
2009 Aug 11
1
nfs MNT include cleanup
2ad780978b7c0c3e7877949f098cbd06e7c73839 broke klibc build MNTPROC_MNT and MNTPROC_UMNT no longer defined. usr/kinit/nfsmount/mount.c: In function ?mount_call?: usr/kinit/nfsmount/mount.c:179: error: ?MNTPROC_MNT? undeclared (first use in this function) usr/kinit/nfsmount/mount.c:179: error: (Each undeclared identifier is reported only once usr/kinit/nfsmount/mount.c:179: error: for each function it appears in.) usr/kinit/nfsmount/mount.c: In function ?mount_v2?: usr/kinit/nfsmount/moun...
2006 Jan 27
5
How to convert decimals to fractions
...0 0.0133333333333333 0.04 2256 488 230 0.0666666666666667 0.0933333333333333 0.106666666666667 2342 310 726 0.133333333333333 0.146666666666667 0.16 179 750 163 0.186666666666667 0.2 0.226666666666667 194 180 57 0.253333333333333 0.266666666666667 0.293333333333333 1 10 40 0.32 0.333333...
2012 Sep 01
5
R_closest date
...2 14 4549 2002-08-21 2002-11-14 85 91 1 15 4549 2002-08-21 2003-02-18 181 89 1 16 4549 2002-08-21 2003-05-15 267 109 2 17 4549 2002-08-21 2003-12-16 482 96 1 128 4839 2006-11-28 2006-11-28 0 179 2 I need to find, the single observation, which has the closest date of 'OBS_DATE' to 'IDX_DT'. For example, for 'PT_ID' of 4549, I need row 13, of which the OBS_DATE is just one day away from IDX_DT. I was thinking about using abs(), and I got this: baseline<...
2003 Jun 07
3
tinc-1.0pre8 fails to compile on RH 9.0
...##m4-files-end/,$p' Makefile.am.in >> Makefile.amt chmod a-w Makefile.amt mv Makefile.amt Makefile.am gmake: Leaving directory `/home/shashank/temp/tinc/m4' Running aclocal -I m4 ... Running autoheader... configure.in:39: warning: AC_CANONICAL_HOST invoked multiple times configure.in:179: error: `po/Makefile.in' is already registered with AC_CONFIG_FILES. autoconf/status.m4:844: AC_CONFIG_FILES is expanded from... configure.in:179: the top level autom4te: /usr/bin/m4 failed with exit status: 1 autoheader: /usr/bin/autom4te failed with exit status: 1 Running automake --gnu ......
2007 Dec 05
1
Calculating large determinants
...w York}, year = {2001} } One of these methods involves an "empirical information matrix" which is the matrix of products of parameter scores at the observation level evaluated at the MLE and summed over all observations. For example a six-component mixture will have 6 - 1 + 29*6 = 179 parameters. So for observation i I form the 179 by 179 matrix of products of scores and sum these up over all 1500-odd observations. Actually it is the log of the determinant of the resultant matrix that I really need rather than the matrix itself. I am seeking advice on what may be the best way t...