similar to: Problem with lme4

Hello, I’m trying to perform a REML analysis using the lmer() function (lme4 package). Well, it seems to work well, except that I’m not getting any p-value (see example below). Can someone tell me what I did wrong? Thanks for your help, Amélie > library(gdata) > dive <- read.xls("C:/Documents and Settings/Amelie/My Documents/Postdoc/CE 2005-2006/divebydive.xls",

Hello, Could someone explain to me why I get so different histograms, in terms of bar spacing, depending on the number of counts entered ? (see example below) > test <- c(0,1,1,1,1,0,0,0,0,0,2,3,2,2,2,3,3,4,5,6,7,5,4,3,4,2,2) > hist(test) I obtain this kind of histogram (what I actually want), i.e. large bars with no space between them x xx xxx xxxx xxxxx xxxxxx

I am trying to compare Vbert growth curves from several years of fish data. I am following the code provided by: http://www.ncfaculty.net/dogle/fishR/gnrlex/VonBertalanffy/VonBertalanffy.pdf. Specifically the section on VBGM Comparisons between groups. ? This code is pretty cut and dry. I am able to run it perfectly with the "fake" data that is provided. But when I run it with my own

Hello, I’m trying to fit the following model: Dependent variable: MAXDEPTH (the maximum depth reached by a penguin during a given dive) Fixed effects: SUCCESSMN (an index of the “individual quality” of a bird), STUDYDAY (the day of the study, from -5 to 20, with 0=Dec 20), and the interaction SUCCESSMN*STUDYDAY Random effect: BIRD (the bird id, as each bird is performing several dives)

| Confirmed for R-devel (current) on Ubuntu 17.10. But ... isn't the regexp | you use wrong, ie isn't R-devel giving the correct answer? No, I don't think R-devel is correct (or at least consistent with the documentation). My interpretation of gsub("(\\w)", "\\U\\1", entry, perl = TRUE) is "Take every word character and replace it with itself, converted to

Hello, I discovered SAGA, an interesting free GIS, a few days ago and now, I would like to use it from within R 2.6.2 using the RSAGA package. I read the documentation for this package and thought that I understood it correctly for trying to call some of the SAGA modules. For getting the information on the usage of and arguments required by the SAGA command line "Import Binary Raw

Hello all, I am trying to apply a conjoint analysis in order to determine the best profile that captures the most preferred combination of levels of given categorical factors. For this a set of factors is given and initially a fractional factorial design has to be produced as a subset of all possible factor levels combinations, sufficient to estimate the main effects utilities. Then the

Pls advise how I can use R in conjoint analysis?? regds Faisal Afzal Siddiqui Karachi, Pakistan ____________________________________________________________________________________ Looking for last minute shopping deals?

Hello everyone, I am new to this list and the R-Project, so I hope my question is not trivial or has been answered before. I searched the FAQs and the mailing list archives and I could not find anything about Conjoint Analysis. I am especially interested in Choice-based Conjoint, resp. discrete choice models. Is there a function / module that handles this issue? Or can the multinomial logit

Hi ! >From an Ensembl annotation like ENSGxxxx /// ENSGyyyyy /// ENSGzzzz, I am trying to keep only the first part: ENSGxxxx. I wasn't able to find any helpful information about how to do it. Could you help me with that please ? Is the use of the equivalent to the Excel * (any text) a good way of doing it and how ? Your help will be very much appreciated. Amelie [[alternative

Hello, The 179th and 180th elements of my list of lists look like this: [[179]] [[179]]$desc [1] ">ipi|IPI00646510|IPI00646510.2 ISOFORM P60-HCK OF TYROSINE-PROTEIN KINASE HCK." [[179]]$seq [1] "MGGRSSCEDPGCPRDEERAPRMGCMKSKFLQVGGNTFSKTETSASPHCPVYVPDPTSTIKPGPNSHNSNTP GIREAGSEDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVDSLETEE

Hello, I would like to know if there is any function in R which allows to make designs of experiments for Choice-Based Conjoint studies ? I have already checked the topic on " design of experiments with R " and looked at the different libraries. I tried to make my design with the "optFedorov" function but I haven't found how it can allow to have balanced design (with the

in order to know which production the custumer most like,i design a question as follow : Q:there are six production listed below.according to your preference,the production you like most is_____,the production you secondly like is ____,and the third is_____. productionA productionB productionC productionD productionE productionF when the data is collected. i type in a

I was told to re-raise this issue with R-dev: In the documentation of R-dev and R-3.4.3, under ?gsub > replacement > ... For perl = TRUE only, it can also contain "\U" or "\L" to convert the rest of the replacement to upper or lower case and "\E" to end case conversion. However, the following code runs differently: tempf <- tempfile()

L.S. We would like to generate fractional design for a conjoint analysis. For example we would like to reduce 2x2x2x2x3 --> 12-16 profiles. We tried the R-package "conjoint" and we found an article which describes how to make fractional design for these kinds of studies with Algdesign: http://tolstoy.newcastle.edu.au/R/e10/help/att-8876/DCE_with_R.pdf However, the generated

Afternoon everyone, I''ve spent the last week or so looking at all the experimental design packages I can find in R. AlgDesign, design.conf and BHH2 being the best one I could find. Unfortunately none of these do a particularly good job for complex designs, in particular for conjoint or discrete choice. (or perhaps they do, and I can''t make them work correctly)

Hello all, I'd like to announce the availability of a mailing list for a newly-formed SIG (Special Interest Group) dedicated to using R for Discrete Choice Modelling. This list is intended for discussion of issues revolving around the design and analysis of Discrete Choice (aka Stated Choice, Stated Preference or Choice-Based Conjoint) experiments. While R has good infrastructure for

Dear all, I am trying to model variation of distribution of species assemblages according to environmental variables. For that I use a log linear multinomial regression. In order to select variables that mostly discriminate the assemblages, I tried to apply a hierarchical partitioning protocol to my data set. For that I have adapted the all.regs() for multinomial model. The problem is that I

Hi, I am running a mixed-effect model with a nested-random effect. I am interested in gut parasites in moose. I has three different type of treatment that I applied to moose which are from different "families". My response variable is gut parasites and the factors are moose families which is nested within treatment. My data is balanced. To answer this question, I used the lme function

I am looking into using the multinomial logistic regression option in the nnet library and have two questions about formatting the data. 1. Can data be analysed in the following format or does it need to be transformed into count data, such as the housing data in MASS? Id Crime paranoia hallucinate toc disorg crimhist age 1 2 1 0 1 0 1 25 2 2 0 1 1 1 1 37 3 1 1 0 1 1 0 42 4 3 0