similar to: Missing p-values using lmer()

Hello, I’m trying to fit the following model: Dependent variable: MAXDEPTH (the maximum depth reached by a penguin during a given dive) Fixed effects: SUCCESSMN (an index of the “individual quality” of a bird), STUDYDAY (the day of the study, from -5 to 20, with 0=Dec 20), and the interaction SUCCESSMN*STUDYDAY Random effect: BIRD (the bird id, as each bird is performing several dives)

Hello, Could someone explain to me why I get so different histograms, in terms of bar spacing, depending on the number of counts entered ? (see example below) > test <- c(0,1,1,1,1,0,0,0,0,0,2,3,2,2,2,3,3,4,5,6,7,5,4,3,4,2,2) > hist(test) I obtain this kind of histogram (what I actually want), i.e. large bars with no space between them x xx xxx xxxx xxxxx xxxxxx

| Confirmed for R-devel (current) on Ubuntu 17.10. But ... isn't the regexp | you use wrong, ie isn't R-devel giving the correct answer? No, I don't think R-devel is correct (or at least consistent with the documentation). My interpretation of gsub("(\\w)", "\\U\\1", entry, perl = TRUE) is "Take every word character and replace it with itself, converted to

Hi - I'm having a problem trying to use the function GLMM() from lme4. Here is what happens: > library(lme4) Loading required package: Matrix Loading required package: lattice > f1 <- GLMM(success~yearF, data=quality, random=~1|bandnumb, family=binomial, method=PQL) Error: couldn't find function "GLMM" I remember having used lme4 before, without any problem.

I was told to re-raise this issue with R-dev: In the documentation of R-dev and R-3.4.3, under ?gsub > replacement > ... For perl = TRUE only, it can also contain "\U" or "\L" to convert the rest of the replacement to upper or lower case and "\E" to end case conversion. However, the following code runs differently: tempf <- tempfile()

Hi ! >From an Ensembl annotation like ENSGxxxx /// ENSGyyyyy /// ENSGzzzz, I am trying to keep only the first part: ENSGxxxx. I wasn't able to find any helpful information about how to do it. Could you help me with that please ? Is the use of the equivalent to the Excel * (any text) a good way of doing it and how ? Your help will be very much appreciated. Amelie [[alternative

Hello, The 179th and 180th elements of my list of lists look like this: [[179]] [[179]]$desc [1] ">ipi|IPI00646510|IPI00646510.2 ISOFORM P60-HCK OF TYROSINE-PROTEIN KINASE HCK." [[179]]$seq [1] "MGGRSSCEDPGCPRDEERAPRMGCMKSKFLQVGGNTFSKTETSASPHCPVYVPDPTSTIKPGPNSHNSNTP GIREAGSEDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVDSLETEE

Dear all, I am trying to model variation of distribution of species assemblages according to environmental variables. For that I use a log linear multinomial regression. In order to select variables that mostly discriminate the assemblages, I tried to apply a hierarchical partitioning protocol to my data set. For that I have adapted the all.regs() for multinomial model. The problem is that I

Hi, I am running a mixed-effect model with a nested-random effect. I am interested in gut parasites in moose. I has three different type of treatment that I applied to moose which are from different "families". My response variable is gut parasites and the factors are moose families which is nested within treatment. My data is balanced. To answer this question, I used the lme function

I think the problem in R-devel happens when there are non-ASCII characters in any of the strings passed to gsub. txt <- vapply(list(as.raw(c(0x41, 0x6d, 0xc3, 0xa9, 0x6c, 0x69, 0x65)), as.raw(c(0x41, 0x6d, 0x65, 0x6c, 0x69, 0x61))), rawToChar, "") txt #[1] "Am?lie" "Amelia" Encoding(txt) #[1] "unknown" "unknown" gsub(perl=TRUE,

I am new to R (ex SAS user) , and I cannot merge two data frames without getting duplicated rows in the results. How to avoid this happening without using the unique() function? 1. First data frame is called "tmv" with 6 variables and 239 rows: > tmv[1:10,] temps nom prenom sexe dist style 1 01:59:36 Cyr Steve H 45 free 2 02:09:55 Gosselin

Hello, I am using the function mda of the mda library in order to discriminate 4 groups with 8 explanatory variables. I only have 66 observations. I tested all possible combinations of those variable and run for each the Mixture Discriminant Analysis. For some iterations, I got an error message: "error in kmeans(xx, start): initial centers are not distinct". I understood that the

Hi folks, I'm a Linux user from Germany (more details about me at ameliezapf.com) and use Wine to run Origin 6.1 (the scientific graphics program). That seems to all go fine, and indeed it did when I used the Wine included in SuSE 9.0 (Wine20030813). Now I've upgraded to SuSE 9.2 (Wine 20040813) and suddenly, the paper sizes do not get handed through to Origin anymore. No matter if I

Hello Amelie, I don't have an answer to your question, but I just wanted to point out this page I noticed recently ( http://hlplab.wordpress.com/2009/05/07/multinomial-random-effects-models-in-r/), which might be helpful. I'm also interested in figuring out how to do a multinomial glmm, so if you find out anything I'd be happy to hear more about it! Based on what I've found so

The Wine development release 1.1.44 is now available. What's new in this release (see below for details): - Many more new icons. - Support for 32-bit prefixes with a 64-bit Wine. - Many additional msvcr80/90 functions. - Improvements to Bidi handling. - More complete mmdevapi (Win7 audio) support. - Improved handling of MSI patches. - A number of fixes for desktop menus. -

Hello, I discovered SAGA, an interesting free GIS, a few days ago and now, I would like to use it from within R 2.6.2 using the RSAGA package. I read the documentation for this package and thought that I understood it correctly for trying to call some of the SAGA modules. For getting the information on the usage of and arguments required by the SAGA command line "Import Binary Raw

hello, we are french student, we have problem for export the test on Excel. we didn't succed for save and name the test so we can't export it... can you help us please thanks _________________________________________________________________ mobile comme sur PC ! http://mobile.live.fr/messenger/bouygues/