Displaying 20 results from an estimated 600 matches similar to: "run perfect in v.0.9.56 but fail in v.1.1.13, help!!"
2014 Feb 12
4
¿Máquina virtual gratuita con Linux y R ya instalado?...
Hola,
¿Sabéis si hay algún sitio en el que se pueda descargar una máquina virtual
gratuita con Linux (cualquier distro) que ya tenga R instalado?
He mirado en la red y tan sólo he encontrado un sitio en el que están
disponibles máquinas virtuales de diferentes distribuciones Linux:
http://virtualboxes.org/images/
Pero no he encontrado ningún sitio en el que además la distribución de
Linux
2014 Feb 12
2
¿Máquina virtual gratuita con Linux y R ya instalado?...
Olmo, Miguel Ángel,
Muchas Gracias!
Se agradece el que lo pongáis tan fácil.
Como va a estar todo actualizado a lo último, y vaya no me corre una
especial prisa, sí que me gustaría tener acceso a lo que estáis preparando
Miguel Ángel.
Ya me dices lo que tengo que hacer...
Gracias de nuevo,
Carlos Ortega
www.qualityexcellence.es
El 12 de febrero de 2014, 11:58,
2010 Jan 27
1
Full Virtualized DomU won't boot
Hi, I use Centos 5.4 x86_64
kernel used is 2.6.18-164.11.1.el5xen
I have a physical machine running Debian Etch (32 bit) and Debian
Lenny and I virtualized the first one as follows:
*Created a HVM DomU with Virt-Manager with a virtual disk file of 40000 M
*Boot from LiveCD, and created a swap and a ext3 partitions (Yes, very
simple layout).
*Rsync'd files from root partition of physical
2025 Jan 18
2
Different behavior when client uses "sec=none" and when provides bad user (mapped to guest)
Thanks a lot for your analysis. I just wanted to add that I think we are
not using at all? The client is an embedded Linux/FPGA machine and it
doesn't have mount.cifs . I think it is using
https://wiki.samba.org/index.php/LinuxCIFSKernel . It comes default with
kernel 5.15 but I tried with a 6.10 and same problem happens.
Best Regards,
Carlos A. Balseiro
El 2025-01-18 11:32, Rowland
2005 Jul 17
1
routing based on user id
Hi all!
I''ve got 2 (soon 3) internet connection. 1 - via ADSL, 2(and3) via ppp
My network:
http://desima.objectis.net/network-diag
linux1:
user1.user2
eth0=192.168.1.1
ppp0=192.168.5.2( gw 192.168.5.1)
gw=192.168.1.2 ( thru ADSL)
compA=192.168.1.6
compB=192.168.1.15
gw2=192.168.1.217 via ppp to different ISP
All works for compA and CompB,
user1 should use default gw(192.168.1.2)
2002 Oct 17
2
Help
Hello,
I already download rm160.sit to a iMac9.1 computer.
But I can not run R-icon for installation of R. The
computer told me --the application "R" could not be
opend because
"Carbonlib" could not be found. I donot know why I
could not install R to the computer.
Thank you.
Jinbo
__________________________________________________
Faith Hill - Exclusive Performances,
2008 Aug 06
4
Font size in plots (I do NOT understand par help)
Hi,
I do not get how par works, help please.
Let's say I have a simple plot: plot(1:10)
I want to change the font size for the x axis... how do I do that?
Thank you,
Stephane
--
The Wellcome Trust Sanger Institute is operated by Genome Research
Limited, a charity registered in England with number 1021457 and a
compa
ny registered in England with number 2742969,
2012 Apr 09
1
Pairwise comparison matrix elements
Hi!,
I'm really hoping someone out there will be able to help me.
I recently started my MSc dissertation on Population Projection Matrices, which has been going well until now. I am trying to set-up a general script that does a pairwise comparison of all elements in my matrices.
So for example, given that I have the following matrix S:
> S
[,1] [,2] [,3]
[1,]
2014 Aug 21
2
pregunta
Buenas noches Javier y José,
Estoy en contra de usar attach(), asi que propongo la siguiente alternativa
con with():
# paquete
require(epicalc)
# los argumentos en ... pasan de epicalc:::cc
# ver ?cc para mas informacion
foo <- function(var1, var2, var3, ...){
or1 <- cc(var1, var2, ...)
or2 <- cc(var1, var3, ...)
list(or1 = or1, or2 = or2)
}
# datos
x <-
2004 Apr 16
3
plug-in for cep 2.1
I´d like to know if there is a plug-in for cep where i can see *.ogg files
since I know it is way better than mp3 or similars.
Thank you!
_________________________________________________________________
Charla con tus amigos en línea mediante MSN Messenger:
http://messenger.latam.msn.com/
<strong>attached mail follows:</strong><hr noshade>
<HEAD><META
2004 Oct 15
2
edit plots from the ADE4 package
Dear R-Help
i have a newbie question, how edit size fonts and colors in the plots (scatter.acm or dudi.acm function) of multiple correspondence analysis in the ADE4 Package?
thanks?
Rafael Gutierrez
Estad??stico
Unidad de Tecnolog??a Cerro Matoso S.A.
Tel. 4-7723350 Fax. 4-7723236
*************************************************************************************************
Este correo
2009 Jan 26
2
Shell Script - Compare packages. rpm.
Hi,
I need a script which makes the package compa??o rpm's through two
text files ...
Since a file is the output of the command *rpm-qa > pkg.out *
And the second file is a list of several packages rpm's, multiple
versions and architectures.
My idea is to compare a package *x* file pkg.out with several
packages *y* of the file update.out and know
2008 Jul 08
2
attributing values to dataframe positions following eval
Hi everybody,
I've been looking around, but can't seem to find the answer.
I get a list of names (which vary, so I never know them in advance), and
transform them into variables, each of which is a dataframe, using
assign:
polyList <- c("rs123", "rs124", "rs555", "rs000")
numPoly <- length(polyList)
for (k in 1:numPoly) {
2015 Jan 06
2
Eventos de una serie de tiempo
Saludo estimados compañeros y compañeras
Tengo una matriz de datos de 51 filas por 160 columnas, Cada columna es una
serie de tiempo.
Existe alguna libreria q me calcule la posicion de la fila donde se hallan
estos maximos y minimos o los eventos de estas curvas
Agradezco la atencion
CARLOS ANDRES
[[alternative HTML version deleted]]
2009 Apr 23
1
Accessing all the first sub-elements of a list of list
Hello,
The 179th and 180th elements of my list of lists look like this:
[[179]]
[[179]]$desc
[1] ">ipi|IPI00646510|IPI00646510.2 ISOFORM P60-HCK OF TYROSINE-PROTEIN
KINASE HCK."
[[179]]$seq
[1]
"MGGRSSCEDPGCPRDEERAPRMGCMKSKFLQVGGNTFSKTETSASPHCPVYVPDPTSTIKPGPNSHNSNTP
GIREAGSEDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVDSLETEE
2007 May 04
2
need more knowledge about asterisk
Hi all,
I am working wit a Mandriva 2007 and have installed the asterisk svn 1.4
with success. I also used the patch for cellphones and it works perfectly. I
was that happy that I decided to buy a TDM11B and it works.
Now, I want to study a bit the code used by this people. Does anybody know
how can I go deeper in this code with funcitonal bloqs in order to
understand how is possible to
2012 Mar 06
1
ROracle package
Hello everybody.
I'm a newbie in R in a debian and linux in general
I'm trying install roracle in my debian 64 bit system. I've read the
http://cran.r-project.org/web/packages/ROracle/INSTALL and I've
installed Oracel Instant Client by rpm package (using alien to deb convert).
When I try to install I write
export
2016 Mar 02
2
nueva distribución de R y problema solucionado
Hola, ¿qué tal?
Sobre
El 2 de marzo de 2016, 11:06, <miguel.angel.rodriguez.muinos en sergas.es>
escribió:
>
> Que Microsoft tenga su propia versión de R y (si es el caso) su propia
> versión de los paquetes... con lo dados que han sido en el pasado a
> "tirar por su cuenta".. no sé yo...
>
> Opiniones?
creo que, en primer lugar, deberíamos felicitarnos con
2008 Feb 29
2
Wine 0.9.56 for Ubuntu and Debian
Hi there,
Does anyone know when 0.9.56 will be available for Ubuntu?
Thanks in advance !
Aaron
2008 Mar 11
0
wine-0.9.56-1.fc7 . Success with Visio 5. Problems with cups-pdf
Hi,
I am running wine-0.9.56-1.fc7 on a Fedora 7 system. I installed Visio 5
(must be around 10 years old!). The Visio seems stable when running under
wine, the graphics are good and I can save the vsd files under wine.
Two small problems
1. Unable to save complex diagrams to jpg or gif. For example, there is an
Office furniture template which includes walls, chairs and tables. The
simple