similar to: Introduction and question regarding the WINEPS printing system

Hi, (Sorry for the cross-posting.) After manually installing the 32-bit libjack packages on my 64-bit system, the original problem ("Can't connect to JACK") is gone; now I get a whole new set of errors instead :) When I try to start the Kontakt 5 VST from festige (via fst, via WINE), this is what I get: ============================ ----------------yo... lets see...

Hello, I'm trying to use rpcclient to add a driver to a Samba 3.0.25 running on Gentoo. When I run the script below, rpcclient prints out the same message as if "--help" was submitted as the only switch. #!/bin/bash -x RPC="/usr/local/samba/bin/rpcclient" ARCH='Windows NT R4000' #ARCH='Windows NT x86' DRIVER='HP LaserJet 4Si/4Si MX

Need new Music on Hold for your PBX? Signate is happy to make a variety of classical music selections available, sampled at rates that are appropriate for telephony. There is no charge. The selections feature Elena Kuschnerova, pianist, and Lev Guelbard, violinist, playing public domain pieces that will give callers a classic impression of you or your company . Click on the link to see a list

Hi all, I have 2 data frames the first contains a list with repeats of words and an associated response time (RT) measure for each word. The second is a tabulation of each unique word and other information such as the amount and of responses for each word. I need to determine the mean RT for each word and add that as a column in the second data frame. Any help would be appreciated Cheers

Sounds like a good start. However, think what it would mean if we could get rid of any residual. In the best case scenario, the output would be a series of function coefficients describing a wave, and a length parameter. In the case of music, you can reasonably expect an unforseeable attack and a consistent decay for each sound component. That means if you can totally describe the first wave to

ERMX Continues To Expand As Stock Climbs Up 16.6%! EntreMetrix Inc. (ERMX) $0.21 UP 16.6% ERMX announced further expansion with K-9 Genetics. Healthy and Premium dog foods grossed $3.6 Billion in 2006, up from $1.9 billion in previous years. Read up on ERMX over the holiday, we think you will see even more fireworks on Thursday morning! I may need one like this. " "Happy" and

ERMX Continues To Expand As Stock Climbs Up 16.6%! EntreMetrix Inc. (ERMX) $0.21 UP 16.6% ERMX announced further expansion with K-9 Genetics. Healthy and Premium dog foods grossed $3.6 Billion in 2006, up from $1.9 billion in previous years. Read up on ERMX over the holiday, we think you will see even more fireworks on Thursday morning! I may need one like this. " "Happy" and

I think the problem in R-devel happens when there are non-ASCII characters in any of the strings passed to gsub. txt <- vapply(list(as.raw(c(0x41, 0x6d, 0xc3, 0xa9, 0x6c, 0x69, 0x65)), as.raw(c(0x41, 0x6d, 0x65, 0x6c, 0x69, 0x61))), rawToChar, "") txt #[1] "Am?lie" "Amelia" Encoding(txt) #[1] "unknown" "unknown" gsub(perl=TRUE,

| Confirmed for R-devel (current) on Ubuntu 17.10. But ... isn't the regexp | you use wrong, ie isn't R-devel giving the correct answer? No, I don't think R-devel is correct (or at least consistent with the documentation). My interpretation of gsub("(\\w)", "\\U\\1", entry, perl = TRUE) is "Take every word character and replace it with itself, converted to

I am new to R (ex SAS user) , and I cannot merge two data frames without getting duplicated rows in the results. How to avoid this happening without using the unique() function? 1. First data frame is called "tmv" with 6 variables and 239 rows: > tmv[1:10,] temps nom prenom sexe dist style 1 01:59:36 Cyr Steve H 45 free 2 02:09:55 Gosselin

Hi - I'm having a problem trying to use the function GLMM() from lme4. Here is what happens: > library(lme4) Loading required package: Matrix Loading required package: lattice > f1 <- GLMM(success~yearF, data=quality, random=~1|bandnumb, family=binomial, method=PQL) Error: couldn't find function "GLMM" I remember having used lme4 before, without any problem.

Hi ! >From an Ensembl annotation like ENSGxxxx /// ENSGyyyyy /// ENSGzzzz, I am trying to keep only the first part: ENSGxxxx. I wasn't able to find any helpful information about how to do it. Could you help me with that please ? Is the use of the equivalent to the Excel * (any text) a good way of doing it and how ? Your help will be very much appreciated. Amelie [[alternative

Hello, The 179th and 180th elements of my list of lists look like this: [[179]] [[179]]$desc [1] ">ipi|IPI00646510|IPI00646510.2 ISOFORM P60-HCK OF TYROSINE-PROTEIN KINASE HCK." [[179]]$seq [1] "MGGRSSCEDPGCPRDEERAPRMGCMKSKFLQVGGNTFSKTETSASPHCPVYVPDPTSTIKPGPNSHNSNTP GIREAGSEDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVDSLETEE

I've been unable to get a [badly written] commercial application to get past this app's insistence on finding WINEPS.DRV... it complains with "NO DEFAULT PRINTER SELECTED" -- days of searching, reading, trying every approach has me tearing my hair out. Worse, my knowledge of C is ancient (circa 1970)... Can anyone either suggest a patch or pointer to the best place to add code

I'm running Wine 20010305. I am using the WINEPS driver and trying to direct it to various printers on various ports. It seems to output to port LPT1 regardless of the port I specify in the registry and win.ini. Here is a simplified scenario, in which I define only one printer, on LPT2. Can any one tell me what is happening? Follow-up question: Am I limited to 9 printers, on LPT1-LPT9?

A word processor gives me an exception which is flagged as and ole problem with a WINEPS driver. I had wineps.dll and wineps16.dll on older fakewindows directories. I copies to /usr/lib/wine, added as builtin. No change. I had fixed this in the past, do not remember how. Any ideas?

Hi, I was wondering if someone could help me on this issue. I use a windows program that print direct to the printer, but it uses the printer from the printer list, it doesn't use the port directly. On Windows, to use the program I have to install a "Generic / Only Text" printer to work. The program runs on wine without problems. The only problem is to print. I created a raw

Hi, I want to know if somebody knows how to change the default font used by WINEPS. Andr? Carvalho

i need print in wine only plain text , and i need disable postscript printing in wine please help

Hello, I’m trying to perform a REML analysis using the lmer() function (lme4 package). Well, it seems to work well, except that I’m not getting any p-value (see example below). Can someone tell me what I did wrong? Thanks for your help, Amélie > library(gdata) > dive <- read.xls("C:/Documents and Settings/Amelie/My Documents/Postdoc/CE 2005-2006/divebydive.xls",