similar to: Need help with [virt net-create]

On Tue, May 20, 2014 at 01:59:42AM -0700, Srinivas_G_Gowda@dell.com wrote: > Is it possible to configure 2 virtual nics in the same ip range ? Nope, that's unsupported. We need to key various things off the IP address + mask used for the NIC, so you can't have multiple nets with the same address + mask. > Here is what I am trying. > > > **** This works ****************

Thanks Daniel. Why was I trying to do something like this ? Two reasons 1. I was referring to ( Figure 18.4. Virtual network switch running dnsmasq) https://access.redhat.com/site/documentation/en-US/Red_Hat_Enterprise_Linux/6/html-single/Virtualization_Administration_Guide/index.html#sect-network-protocols that appears to be two virtual nics sharing the same IP range .. !!! 2. was

Dear R- Community, to learn i reanalysed some data provided and analysed by Zuur et. al. in their book "Mixed effect models and Extensions in Ecology with R". When i run the last command i get a warning message i dont understand. Loyn<- read.table(file = "loyn.txt",header = TRUE) Loyn$L.AREA<- log10(Loyn$AREA) fGRAZE <-factor(Loyn$GRAZE) M0<- lm(ABUND~ L.AREA

HI, this is my problem I want to subset this file df, using only unique df$exon printing the line once even if df$exon appear several times: unique(df$exon) will show me the unique exons If I try to print only the unique exon lines with df[unique(df$exon),] -this doesn't print only the unique ones :( could you help? thanks Nat exon size chr start

Hi R friends, I've been attempting to create plots with multiple alpha values using Cairo to save them on a windows (32b XP) platform as it doesn't support more than 3 alpha values. This worked well until I wanted a postscript file (unsupported) and as a attempted work around I installed RGtk2. So far so good, however now when I try to use a >CairoPDF("alpha.pdf", 6, 6,

On 03/03/2014 10:44, Martin Kletzander wrote: > On Mon, Mar 03, 2014 at 10:30:11AM +0000, Struan Bartlett wrote: >> Hi Martin >> >> Thanks for your response. Here's the output of that grep: >> >> # grep ^flags /proc/cpuinfo | sort -u >> flags : fpu vme de pse tsc msr pae mce cx8 apic sep mtrr pge mca >> cmov pat pse36 clflush dts acpi mmx

Hi, I do not get how par works, help please. Let's say I have a simple plot: plot(1:10) I want to change the font size for the x axis... how do I do that? Thank you, Stephane -- The Wellcome Trust Sanger Institute is operated by Genome Research Limited, a charity registered in England with number 1021457 and a compa ny registered in England with number 2742969,

Hello, I have a question about using extreme value distribution in R. I have two variables, X and Y, and have pairs of points (X1,Y1),(X2,Y2), (X3,Y3) etc. When I plot X against Y, it looks like the maximum value of Y (for a particular X) is correlated with X. Indeed, when I bin the data by X-value into equally sized bins, and test whether the maximum value of Y for a bin is correlated with

I am analysing some binary data with a mixed effects model using glmmPQL. I am aware that I cannot use the AIC values to help me find the minimum adequate model so how do I perform likelihood ratio tests? I need to fix on the minimum adequate model but I'm not sure of the proper way to do this. Thank you very much, Elizabeth Boakes Elizabeth Boakes PhD Student Institute of Zoology

Hi - If I have a hypothetical distribution as an array distribution<-c(0,1,2,3,4,5,6,7,8,9) and I want to find the probability there is a value smaller than a new value. new_value<-4 (such that I'd get this type of output) new_value p-value 4 0.5 3.4 0.4 3 0.4 0 0.1 -1 0.0 Thanks for the help, I bet this is really easy... :/ Stephen -- The Wellcome Trust Sanger Institute is

Hello, I was wondering if anyone knew of an R function/R code to plot bivariate (3 dimensional) partial dependence plots in random forests (randomForest package). It is apparently possible using the rgl package (http://esapubs.org/archive/ecol/E088/173/appendix-C.htm) or there may be a more direct function such as the pairplot() in MART (multiple additive regression trees)? Many

Hello, The 179th and 180th elements of my list of lists look like this: [[179]] [[179]]$desc [1] ">ipi|IPI00646510|IPI00646510.2 ISOFORM P60-HCK OF TYROSINE-PROTEIN KINASE HCK." [[179]]$seq [1] "MGGRSSCEDPGCPRDEERAPRMGCMKSKFLQVGGNTFSKTETSASPHCPVYVPDPTSTIKPGPNSHNSNTP GIREAGSEDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVDSLETEE

Hi Martin Thanks for your response. Here's the output of that grep: # grep ^flags /proc/cpuinfo | sort -u flags : fpu vme de pse tsc msr pae mce cx8 apic sep mtrr pge mca cmov pat pse36 clflush dts acpi mmx fxsr sse sse2 ss ht tm pbe syscall nx pdpe1gb rdtscp lm constant_tsc arch_perfmon pebs bts rep_good nopl xtopology nonstop_tsc aperfmperf eagerfpu pni pclmulqdq dtes64 monitor

Hi, I have been trying to plot density plots using the example on: http://addictedtor.free.fr/graphiques/graphcode.php?graph=139 I used to use this function, but I cannot get any old code or even the example to work. library("geneplotter") require("RColorBrewer") x1 <- matrix(rnorm(1e4), ncol=2) x2 <- matrix(rnorm(1e4, mean=3, sd=1.5), ncol=2) x <-

I am analysing binomial data using a generalised mixed effects model. I understand that if I use glmmPQL it is not appropriate to compare AIC values to obtain a minimum adequate model. I am assuming that this means it is also inappropriate to use AIC values from lmer since, when analysing binomial data, lmer also uses PQL methods. However, I wasn't sure so please could somebody clarify

Hi All I have a column/variable called time difference. It has a whole list of numbers from 0 through to the hundreds eg 236. I want to assign a corresponding "name" to each variable from a predefined list: Month or less, 1 -2 months, 2-3 months etc So the result would look something like: Time Difference Month 1 Month or

Hi everybody, I've been looking around, but can't seem to find the answer. I get a list of names (which vary, so I never know them in advance), and transform them into variables, each of which is a dataframe, using assign: polyList <- c("rs123", "rs124", "rs555", "rs000") numPoly <- length(polyList) for (k in 1:numPoly) {

On 03/03/2014 10:55, Martin Kletzander wrote: > On Mon, Mar 03, 2014 at 10:47:03AM +0000, Struan Bartlett wrote: >> On 03/03/2014 10:44, Martin Kletzander wrote: >>> On Mon, Mar 03, 2014 at 10:30:11AM +0000, Struan Bartlett wrote: >>>> Hi Martin >>>> >>>> Thanks for your response. Here's the output of that grep: >>>>

Hi we're running 3.0.1 on Solaris 9 ( with NIS/flat files as the NS ) as a member server of the AD domain ( via kinit and then net join ). there's a couple of things we've noticed and I'm not sure if they're just the way it works or configuration problems: (1) we assign the gid an uid mappings with idmap in smb.conf and I thought that winbindd would not assign uid/gids if

The list of your interest is R-help not R-sig-mac stefano Il giorno 26/gen/06, alle ore 01:20, Sylvain Charlat ha scritto: > Hi, > > Is there any simple way to get histogram for different levels of > factor? > > Say you have the following data set: > > Island Sp.diam > Moorea 1.21 > Moorea 1.27 > Moorea 1.28 > Moorea 1.22 > Moorea 1.28 > Rurutu