similar to: in honor of fredrick sanger

I am using samba to share my RedHat V5.0 printers to my MS Network clients, but I get an extra blank page at the end of each print job. I've looked at the printcap man pages, but haven't been successful in getting rid of the trailing blank page. Here's the printcap section for the printer I've been having problems with: # /etc/printcap parallel:\ :sd=/var/spool/lpd/lp2:\

Hi, I'm using version 0.99.10.8 on debian 2.4.26 and am getting this problem, can someone please shed some light over this? Aug 31 13:58:58 xxx imap(someone): file_wait_lock() failed with modify log file /var/mail/someone_new/Maildir/.INBOX/.imap.index.log: Resource temporarily unavailable and then: Aug 31 14:00:58 xxx imap(someone): Couldn't lock modify log file

Hello, I installed OpenSSH_3.7p1 on 2 AIX 4.3.3 servers last week and had this problem on both of them. On the first server I finally re-installed the package and that fixed it. I tried re-installing it multiple times on the second server and still have the same issue. I have checked everything that I can think of and spent many hours looking for a solution. Both servers have the same csh.cshrc

Hello All, I am new to R and tried to install R in Linux system (OS: Open SUSE). After untar the source code, changed the directory, and typed the command ./configure, it was checking a list...finally it gave an error message. Here with i have enclosed the error message. Check-list goes like this: checking if g++ supports -c -o file.o... yes checking if g++ supports -c -o file.o... (cached) yes

Hi all, I'm trying to get rsync running on a Windows 2k box (my tape backup server) to remotely back up stuff from a few unix boxes. Not my favored constellation, but there's not much I can do about that. I'm hoping someone could give me a quick tip or two on getting rsync working as a Win2k service. I'm not real proficient with Win2k, so be gentle. The posts I could find

I've been struggling with this for about a week now, so let me ask this question first. Can you use a Server 2003 Active Directory to authenticate windows users trying to access a share on the Samba 3 server? Is this possible? Has anyone done this successfully? I need to be able to allow my windows users to use their 2003 AD account info to access shares on the Samba 3 server. Once again

Hi Sorry, I am clearly missing something here. I want to read this file directly: ftp://ftp.sanger.ac.uk/pub/mirbase/targets/v5/arch.v5.txt.gallus_gallus. zip I tried using read.table(gzfile("ftp://ftp.sanger.ac.uk/pub/mirbase/targets/v5/arch.v5 .txt.gallus_gallus.zip")) But I got an error: Error in open.connection(file, "r") : cannot open the connection In addition:

I would greatly appreciate some example of correct usage of function unz. I have to download and uncompress the following web compressef file: ftp://ftp.sanger.ac.uk/pub/mirbase/targets/v5/arch.v5.txt.homo_sapiens.zip I tried the following command that does not work: Targets.rec <- readLines(zz <- unz("ftp://ftp.sanger.ac.uk/pub/mirbase/targets/v5/arch.v5.txt.homo_sapiens.zip"))

Hi I hope someone can shed some light on this: For some reason when I read.table("bfx.txt") R decides to only give back the first character from each column in each row as one single column. Like this: V1 1 ÿþr 2 \n 3 r 4 1 5 0 6 A 7 G 8 \n 9 r 10 1 11 0 12 T 13 C 14 \n The data should be:

Hi R friends, I've been attempting to create plots with multiple alpha values using Cairo to save them on a windows (32b XP) platform as it doesn't support more than 3 alpha values. This worked well until I wanted a postscript file (unsupported) and as a attempted work around I installed RGtk2. So far so good, however now when I try to use a >CairoPDF("alpha.pdf", 6, 6,

First, apologies for no example data but I don't think it's needed in this case, Q: Can (and if so how ) the line end style be changed for 'cloud' plots? I've tried par(lend=2), trellis.par.set(add.line = list(lend=2)) and much googling but to no avail Thanks in advance Dan P.S. the reason for this is that the round end looks bad at lwd=3 or more Daniel Alcock Malaria

HI, this is my problem I want to subset this file df, using only unique df$exon printing the line once even if df$exon appear several times: unique(df$exon) will show me the unique exons If I try to print only the unique exon lines with df[unique(df$exon),] -this doesn't print only the unique ones :( could you help? thanks Nat exon size chr start

Hi, I would like some extra information on the 'cgh' package in R. I noticed that there isn't much activity regarding this package on the R and BioC mailing list (I googled it). I started using this package and I have few questions: 1/ As I have a custom tiling like array @8um features resolution (affy), I have a lot of probes to work with. I'm assuming it is correct to

Hello Please find bug report attached. Thanks Matthew -- Matthew Gillman Team 105: Variation Informatics Wellcome Trust Sanger Institute, Wellcome Trust Genome Campus, Hinxton, Cambridge, CB10 1SA, UK Tel: 01223 834244 Ext. 4922 -- The Wellcome Trust Sanger Institute is operated by Genome Research Limited, a charity registered in England with number 1021457 and a company registered

Hi The cor function in the stats package calculates the correlation between columns of data, does anyone know if it is at all possible to calculate the correlation between rows instead ? Or is there an appropriate package or function that is more appropriate I'd like to calculate spearman & pearson correlations between rows. Many thanks Jason -- --------------------------------

Hello, The 179th and 180th elements of my list of lists look like this: [[179]] [[179]]$desc [1] ">ipi|IPI00646510|IPI00646510.2 ISOFORM P60-HCK OF TYROSINE-PROTEIN KINASE HCK." [[179]]$seq [1] "MGGRSSCEDPGCPRDEERAPRMGCMKSKFLQVGGNTFSKTETSASPHCPVYVPDPTSTIKPGPNSHNSNTP GIREAGSEDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVDSLETEE

Hello, I have a question about using extreme value distribution in R. I have two variables, X and Y, and have pairs of points (X1,Y1),(X2,Y2), (X3,Y3) etc. When I plot X against Y, it looks like the maximum value of Y (for a particular X) is correlated with X. Indeed, when I bin the data by X-value into equally sized bins, and test whether the maximum value of Y for a bin is correlated with

Dear Krzysztof, I would suggest to have a look at Docker images. https://hub.docker.com/r/rocker/r-ver/ provides images for different versions of R. You could even create your own image with all the packages and other dependencies that you need. See e.g. our image at https://hub.docker.com/r/inbobmk/rstable/ Best regards, ir. Thierry Onkelinx Statisticus / Statistician Vlaamse Overheid /

Hi everybody, I've been looking around, but can't seem to find the answer. I get a list of names (which vary, so I never know them in advance), and transform them into variables, each of which is a dataframe, using assign: polyList <- c("rs123", "rs124", "rs555", "rs000") numPoly <- length(polyList) for (k in 1:numPoly) {

Hi - If I have a hypothetical distribution as an array distribution<-c(0,1,2,3,4,5,6,7,8,9) and I want to find the probability there is a value smaller than a new value. new_value<-4 (such that I'd get this type of output) new_value p-value 4 0.5 3.4 0.4 3 0.4 0 0.1 -1 0.0 Thanks for the help, I bet this is really easy... :/ Stephen -- The Wellcome Trust Sanger Institute is