Displaying 20 results from an estimated 6000 matches similar to: "Replication and LAYOUT=fs"
2013 Jul 26
3
Expunged message reappeared, giving a new UID
I am running dovecot 2.2.2 with tcp based replication, and experiencing
some duplicated emails. `doveconf -n` output is below.
I have narrowed it down to the following scenario:
An email arrives, and is successfully replicated to both nodes. It is in
INBOX/new/ at this point on both servers. 
Connect with a mail client, and delete the message - without delayed
expunge. So, for example, mutt
2010 Apr 27
1
Cairo package failure to load backend
Hi R friends,
I've been attempting to create plots with multiple alpha values using
Cairo to save them on a windows (32b XP) platform as it doesn't support
more than 3 alpha values. This worked well until I wanted a postscript
file (unsupported) and as a attempted work around I installed RGtk2. So
far so good, however now when I try to use a 
>CairoPDF("alpha.pdf", 6, 6,
2009 Apr 23
1
Accessing all the first sub-elements of a list of list
Hello,
 
The 179th and 180th elements of my list of lists look like this:
 
[[179]]
[[179]]$desc
[1] ">ipi|IPI00646510|IPI00646510.2 ISOFORM P60-HCK OF TYROSINE-PROTEIN
KINASE HCK."
 
[[179]]$seq
[1]
"MGGRSSCEDPGCPRDEERAPRMGCMKSKFLQVGGNTFSKTETSASPHCPVYVPDPTSTIKPGPNSHNSNTP
GIREAGSEDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVDSLETEE
2012 Mar 02
3
subseting a data frame
HI,
this is my problem I want to subset this file df, using only  unique 
df$exon printing the line once even if  df$exon appear several times:
unique(df$exon) will show me the unique exons
If I try to print only the unique exon lines
with df[unique(df$exon),] -this doesn't print only the unique ones :(
could you help?
thanks
Nat
                         exon size  chr     start      
2009 Jan 09
1
Calculating p-values from your own distribution as an array
Hi -
If I have a hypothetical distribution as an array
distribution<-c(0,1,2,3,4,5,6,7,8,9)
and I want to find the probability there is a value smaller than a new
value.
new_value<-4
(such that I'd get this type of output)
new_value	p-value
4	0.5
3.4	0.4	
3	0.4
0	0.1
-1	0.0
Thanks for the help, I bet this is really easy... :/ 
Stephen
-- 
 The Wellcome Trust Sanger Institute is
2009 Nov 17
1
strange read.table results
Hi I hope someone can shed some light on this:
 
For some reason when I 
 
read.table("bfx.txt")
 
R decides to only give back the first character from each column in each row as one single column.
 
Like this:
 
    V1
1   ÿþr
2    \n
3     r
4     1
5     0
6     A
7     G
8    \n
9     r
10    1
11    0
12    T
13    C
14   \n
 
The data should be:
 
2009 Dec 14
0
Online help for text() wrong for 'pos' argument. (PR#14136)
Hello
Please find bug report attached.
Thanks
Matthew
-- 
Matthew Gillman
Team 105: Variation Informatics
Wellcome Trust Sanger Institute, Wellcome Trust Genome Campus, Hinxton, Cambridge, CB10 1SA, UK
Tel: 01223 834244 Ext. 4922
-- 
 The Wellcome Trust Sanger Institute is operated by Genome Research 
 Limited, a charity registered in England with number 1021457 and a 
 company registered
2010 Apr 06
1
lattice package: line end style
First, apologies for no example data but I don't think it's needed in
this case,
Q: Can (and if so how ) the line end style be changed for 'cloud' plots?
I've tried par(lend=2),  trellis.par.set(add.line = list(lend=2)) and
much googling but to no avail
Thanks in advance
Dan
P.S. the reason for this is that the round end looks bad at lwd=3 or
more
Daniel Alcock
Malaria
2007 Nov 22
3
question about extreme value distribution
Hello,
I have a question about using extreme
value distribution in R. 
I have two variables, X and Y, and have pairs
of points (X1,Y1),(X2,Y2), (X3,Y3) etc.
When I plot X against Y, it looks 
like the maximum value of Y (for a particular X) is
correlated with X.
Indeed, when I bin the data by X-value into
equally sized bins, and test whether the maximum 
value of Y for a bin is correlated with
2008 Aug 06
4
Font size in plots (I do NOT understand par help)
Hi,
 
I do not get how par works, help please.
 
Let's say I have a simple plot: plot(1:10)
 
I want to change the font size for the x axis... how do I do that?
 
Thank you,
 
Stephane
-- 
 The Wellcome Trust Sanger Institute is operated by Genome Research 
 Limited, a charity registered in England with number 1021457 and a 
 compa
ny registered in England with number 2742969,
2008 Jul 08
2
attributing values to dataframe positions following eval
Hi everybody,
 
I've been looking around, but can't seem to find the answer.
 
I get a list of names (which vary, so I never know them in advance), and
transform them into variables, each of which is a dataframe, using
assign:
 
polyList <- c("rs123", "rs124", "rs555", "rs000")
numPoly <- length(polyList)
 
for (k in 1:numPoly) {
 
2018 Jan 17
0
lost ability to apt-get install r-base=3.4.2-1trusty1
Dear Krzysztof,
I would suggest to have a look at Docker images.
https://hub.docker.com/r/rocker/r-ver/ provides images for different
versions of R. You could even create your own image with all the
packages and other dependencies that you need. See e.g. our image at
https://hub.docker.com/r/inbobmk/rstable/
Best regards,
ir. Thierry Onkelinx
Statisticus / Statistician
Vlaamse Overheid /
2007 Dec 19
1
FW: cgh package
Hi, 
I would like some extra information on the 'cgh' package in R. I noticed
that there isn't much activity regarding this package on the R and BioC
mailing list (I googled it). 
 
I started using this package and I have few questions:
1/ As I have a custom tiling like array @8um features resolution (affy),
I have a lot of probes to work with. I'm assuming it is correct to
2011 Mar 08
2
positions and margins differ between X11 and SVG device
Hi,
I'm trying to get a plot ready for publication, which involves getting
it to look nice at a rather small size and to fine-tune positioning all
the labels and sizes of the margins.
I realise that I may not be doing this the right way and I welcome any
comments about better approaches to do this. What I have done so far is
open an X11 device with the size I want for the final output and I
2007 Sep 21
0
openssh-4.7p1 & RemoteForward to openssh-3.6.1p2 Disconnecting: Bad, packet length
Hi,
I've just upgraded to openssh-4.7p1 on my gentoo box, and I've noticed a incompatibility with openssh-3.6.1p2 running on a redhat AS3 server.
If I ssh from my openssh-4.7_p1 client to the openssh-3.6.1p2 server, and RemoteForward a port, the ssh connection closes if I try to send more than roughly 300K through the tunneled port. The problem isn't present when I use openssh-4.6p1
2014 Dec 16
0
LDAP: Connection appears to be hanging, reconnecting
On 16/12/14 16:30, Matthias Egger wrote:
> What happened:
> A few weeks ago one of the LDAPS Servers which is not maintained by us
> has crashed. From that moment on, users could still login to check their
> emails, but they were not able to send any email through postfix (which
> uses smtpd_sasl_type = dovecot)
>
> What i do not understand, is why did dovecot not switch to
2013 Apr 04
0
Changing HTTP proxy configurations at run time
DeaR developers,
I was recently moving with my laptop between two environments with and without a HTTP proxy server. As the internal proxy configuration is read only once from the environment variables http_proxy/HTTP_PROXY at the first call of download.file(), the proxy configurations couldn't be adjusted at a later stage. (See also the comment in ?download.file). This caused some
2009 Nov 09
0
Formula for calculating interaction terms in R
Hello -
I am trying to figure out R's transformation for interaction terms in a
linear regression.
My simple background understanding is that interaction terms are
generally calculated by multiplying the centred (0-mean) variables with
each other and then doing the regression.  However, in this regard I
would have expected to see the same p-value when I calculate
summary(lm(Y~A:B))
for A:B
2018 Jan 16
2
lost ability to apt-get install r-base=3.4.2-1trusty1
Hello,
I need a specific version of R installed for consistency reasons. I do the standard setup steps:
echo "deb https://cran.ma.imperial.ac.uk/bin/linux/ubuntu trusty/" | sudo tee -a /etc/apt/sources.list
sudo apt-key adv --keyserver keyserver.ubuntu.com --recv-keys E084DAB9
sudo apt-get update
And then a simple install call, which used to work just fine some time ago, tosses an
2009 Feb 19
2
read.table : how to condition on error while opening file?
Hi,
 
I'm using read.table in a loop, to read in multiple files. The problem
is that when a file is missing there is an error message and the loop is
broken; what I'd like to do is to test for the error and simply do
"next" instead of breaking the loop. Anybody knows how to do that?
 
Example: 
 
filelist <- c("file1.txt", "file2.txt",