similar to: Online help for text() wrong for 'pos' argument. (PR#14136)

Hi R friends, I've been attempting to create plots with multiple alpha values using Cairo to save them on a windows (32b XP) platform as it doesn't support more than 3 alpha values. This worked well until I wanted a postscript file (unsupported) and as a attempted work around I installed RGtk2. So far so good, however now when I try to use a >CairoPDF("alpha.pdf", 6, 6,

Hi, I would like some extra information on the 'cgh' package in R. I noticed that there isn't much activity regarding this package on the R and BioC mailing list (I googled it). I started using this package and I have few questions: 1/ As I have a custom tiling like array @8um features resolution (affy), I have a lot of probes to work with. I'm assuming it is correct to

First, apologies for no example data but I don't think it's needed in this case, Q: Can (and if so how ) the line end style be changed for 'cloud' plots? I've tried par(lend=2), trellis.par.set(add.line = list(lend=2)) and much googling but to no avail Thanks in advance Dan P.S. the reason for this is that the round end looks bad at lwd=3 or more Daniel Alcock Malaria

Hi I hope someone can shed some light on this: For some reason when I read.table("bfx.txt") R decides to only give back the first character from each column in each row as one single column. Like this: V1 1 ÿþr 2 \n 3 r 4 1 5 0 6 A 7 G 8 \n 9 r 10 1 11 0 12 T 13 C 14 \n The data should be:

Hi The cor function in the stats package calculates the correlation between columns of data, does anyone know if it is at all possible to calculate the correlation between rows instead ? Or is there an appropriate package or function that is more appropriate I'd like to calculate spearman & pearson correlations between rows. Many thanks Jason -- --------------------------------

Hi further to my upgrade question thanks for pointing me in the right direction any ideas how I get round the following problem: I'm trying to install on a Tru64 alpha ecs1h[jps]69: make `Makedeps' is up to date. `libappl.a' is up to date. `Makedeps' is up to date. `libnmath.a' is up to date. `Makedeps' is up to date. `libunix.a' is up to date. `Makedeps' is up

Hi All Not sure if this a bioconductor question or general R mailing list so apologies if this has gone to the wrong one................. When plotting dendrograms created by hclust you can "identify" clusters by clicking on the graphics and returning a list of what is contained in each cluster. However I'd like to be able to "zoom in" on specific clusters and plot

HI All sorry if this question has already been asked but I couldn't find anything that answered my question I have 24 columns of data that I'm trying to plot in heatmap.2 (gregmisc) and I'm having difficulty ordering them except in numerical sequence: I have transposed my matrix so it will appear with the dendrogram I want appearing at the top of the heatmap If I use either of

Hi - I am interested in solving variance components for the data below with respect to the response variable, Expression within R. However, the covariates aren't independent and they also have a class (of which the total variance explained by covariates in that class I am most interested in). Very naively, I have tried to look at each individual covariates variance like this >

Hello, The 179th and 180th elements of my list of lists look like this: [[179]] [[179]]$desc [1] ">ipi|IPI00646510|IPI00646510.2 ISOFORM P60-HCK OF TYROSINE-PROTEIN KINASE HCK." [[179]]$seq [1] "MGGRSSCEDPGCPRDEERAPRMGCMKSKFLQVGGNTFSKTETSASPHCPVYVPDPTSTIKPGPNSHNSNTP GIREAGSEDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVDSLETEE

HI, this is my problem I want to subset this file df, using only unique df$exon printing the line once even if df$exon appear several times: unique(df$exon) will show me the unique exons If I try to print only the unique exon lines with df[unique(df$exon),] -this doesn't print only the unique ones :( could you help? thanks Nat exon size chr start

Hi - If I have a hypothetical distribution as an array distribution<-c(0,1,2,3,4,5,6,7,8,9) and I want to find the probability there is a value smaller than a new value. new_value<-4 (such that I'd get this type of output) new_value p-value 4 0.5 3.4 0.4 3 0.4 0 0.1 -1 0.0 Thanks for the help, I bet this is really easy... :/ Stephen -- The Wellcome Trust Sanger Institute is

Hi, I'm a sysadmin who's been tasked with installing R on our 1000-node compute cluster. I have licences for the Intel C and FORTRAN compilers, so I'm using the following to compile: CFLAGS="-O2 -axWK" FFLAGS=$CFLAGS CXXFLAGS=$CFLAGS CC=icc F77=ifort CXX=icc FPICFLAGS=-fpic ./configure --without-x --without-tcltk The compilation seems to go OK, with a few warnings.

Hi I know this subject has been mentioned before but from the mail archives I'm under the impression that this is not possible ? I'm trying to carryout the equivalent of ls -l in R to give some date/time label to each of my objects If the case is that there is no equivalent, is it possible to list all objects in an environment that share a common component ? So that the common

Hello, I have a question about using extreme value distribution in R. I have two variables, X and Y, and have pairs of points (X1,Y1),(X2,Y2), (X3,Y3) etc. When I plot X against Y, it looks like the maximum value of Y (for a particular X) is correlated with X. Indeed, when I bin the data by X-value into equally sized bins, and test whether the maximum value of Y for a bin is correlated with

Hi, I do not get how par works, help please. Let's say I have a simple plot: plot(1:10) I want to change the font size for the x axis... how do I do that? Thank you, Stephane -- The Wellcome Trust Sanger Institute is operated by Genome Research Limited, a charity registered in England with number 1021457 and a compa ny registered in England with number 2742969,

Dear Krzysztof, I would suggest to have a look at Docker images. https://hub.docker.com/r/rocker/r-ver/ provides images for different versions of R. You could even create your own image with all the packages and other dependencies that you need. See e.g. our image at https://hub.docker.com/r/inbobmk/rstable/ Best regards, ir. Thierry Onkelinx Statisticus / Statistician Vlaamse Overheid /

Hi everybody, I've been looking around, but can't seem to find the answer. I get a list of names (which vary, so I never know them in advance), and transform them into variables, each of which is a dataframe, using assign: polyList <- c("rs123", "rs124", "rs555", "rs000") numPoly <- length(polyList) for (k in 1:numPoly) {

Hi, I'm trying to get a plot ready for publication, which involves getting it to look nice at a rather small size and to fine-tune positioning all the labels and sizes of the margins. I realise that I may not be doing this the right way and I welcome any comments about better approaches to do this. What I have done so far is open an X11 device with the size I want for the final output and I

Hello, I need a specific version of R installed for consistency reasons. I do the standard setup steps: echo "deb https://cran.ma.imperial.ac.uk/bin/linux/ubuntu trusty/" | sudo tee -a /etc/apt/sources.list sudo apt-key adv --keyserver keyserver.ubuntu.com --recv-keys E084DAB9 sudo apt-get update And then a simple install call, which used to work just fine some time ago, tosses an