similar to: rsync: readdir(.): Bad file descriptor (9)

Hello, The 179th and 180th elements of my list of lists look like this: [[179]] [[179]]$desc [1] ">ipi|IPI00646510|IPI00646510.2 ISOFORM P60-HCK OF TYROSINE-PROTEIN KINASE HCK." [[179]]$seq [1] "MGGRSSCEDPGCPRDEERAPRMGCMKSKFLQVGGNTFSKTETSASPHCPVYVPDPTSTIKPGPNSHNSNTP GIREAGSEDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVDSLETEE

----- Original Message ----- > From: "Amnon Ilan" <ailan@redhat.com> > To: "Vadim Rozenfeld" <vrozenfe@redhat.com>, "Li Jin" <lijin@redhat.com> > Cc: "Richard W.M. Jones" <rjones@redhat.com>, "Roman Kagan" <rkagan@virtuozzo.com>, libguestfs@redhat.com, "Jeff > Nelson" <jenelson@redhat.com>,

On Wed, Nov 18, 2015 at 11:31:17PM -0500, Li Jin wrote: > > > > In any case the *.inf files don't seem to have any distinguishing > > > > feature which would allow us to check this. > > > > > > > > Maybe this doesn't matter? > > > > > > Let me explain how it works: > > > We don't make any difference between

Hi I am an engineer who is making communication systems. I have a board(made by Kontron ltd, Intel CPU, currently with diskless ) that is used in compactPCI. I boot that board with network PXELINUX method and currently using NFS. But I don't want to use NFS and I want to make and use ram disk image. That means I want to use a ram disk as /. Currently I made a initrd by ltsp_initrd_kit. What

Hi, I''ve just been having a look at the scriptaculous drag-n-drop library, which looks exceedingly good. I''m running across a show-stopper here, though - something that''s cropping up in both the online demos and my own test scripts. If I set up two lists so that I can drag items between them, then if either list becomes empty, I can''t drag elements back into

Mapping stable-security to proposed-updates. Accepted: -----BEGIN PGP SIGNED MESSAGE----- Hash: SHA256 Format: 1.8 Date: Tue, 15 Mar 2016 22:18:35 +0100 Source: xen Binary: libxen-4.4 libxenstore3.0 libxen-dev xenstore-utils xen-utils-common xen-utils-4.4 xen-hypervisor-4.4-amd64 xen-system-amd64 xen-hypervisor-4.4-arm64 xen-system-arm64 xen-hypervisor-4.4-armhf xen-system-armhf Architecture:

Accepted: -----BEGIN PGP SIGNED MESSAGE----- Hash: SHA256 Format: 1.8 Date: Tue, 15 Mar 2016 22:18:35 +0100 Source: xen Binary: libxen-4.4 libxenstore3.0 libxen-dev xenstore-utils xen-utils-common xen-utils-4.4 xen-hypervisor-4.4-amd64 xen-system-amd64 xen-hypervisor-4.4-arm64 xen-system-arm64 xen-hypervisor-4.4-armhf xen-system-armhf Architecture: source all amd64 Version: 4.4.1-9+deb8u4

Hello I have a question. I am an engineer who is making communication systems. I have a board(made by Kontron ltd, Intel CPU, currently with diskless ) that is used in compactPCI. I boot that board with network PXELINUX method and currently using NFS. But I don't want to use NFS. NFS is only needed for getting kernel and initrd. I don't want to use NFS after booting and I want to make

Hi Thomas, Here''s a fix for the problem that I raised this morning, turned out to be fairly simple in the end (after many false starts and thrashing about - thank goodness for Venkman!) First, in Sortable.create(), I register the parent element (the UL tag or whatever), and add an extra property to it to mark it as the parent of the list in question: for (var i = 0; i <

Author: Darren Moffat <Darren.Moffat at Sun.COM> Repository: /hg/zfs-crypto/gate Latest revision: 957d30a3607ed9f3cbe490da5894d1e1b2104033 Total changesets: 28 Log message: resync onnv_105 partial for 6713916 Files: usr/src/Makefile.lint usr/src/Targetdirs usr/src/cmd/Makefile usr/src/cmd/Makefile.cmd usr/src/cmd/acctadm/Makefile usr/src/cmd/acctadm/acctadm.xcl

+Li Jin ----- Original Message ----- > From: "Vadim Rozenfeld" <vrozenfe@redhat.com> > To: "Richard W.M. Jones" <rjones@redhat.com> > Cc: "Roman Kagan" <rkagan@virtuozzo.com>, libguestfs@redhat.com, "Amnon Ilan" <ailan@redhat.com>, "Jeff Nelson" > <jenelson@redhat.com>, "Yan Vugenfirer"

Dear all, I try to conduct a SEM / two stage least squares regression with the following equations: First: X ~ IV1 + IV2 * Y Second: Y ~ a + b X therein, IV1 and IV2 are the two instruments I would like to use. the structure I would like to maintain as the model is derived from economic theory. My problem here is that I have trouble solving the equations to get the reduced form so I can run

Dear all Problem: hist()-function, scale = ?percent? I want to generate histograms for changing underlying data. In order to make them comparable, I want to fix the y-axis (vertical-axis) to, e.g., 0%, 10%, 20%, 30% as well as to fix the spaces, too. So the y-axis in each histogram should be identical. Currently, I have 100 histograms and the y-axis scales changes in each. Here is my code:

Hi, I search a way to do rsync on a window share without mount the share. Why ? because i don't want to run my script as root for mount and unmount the share. (it's bad to run scripts as root :-) ) Alternative way is to install rsync on cygwin@windows, but i can't because windows computer are not mine. Why rsync (made by the creator of Samba) can't read a window share ?

I think I've found out why MacOS 10.5.x (Leopard) clients are unable to connect to Samba shares when authenticating with Kerberos. Basically, the Leopard Macs insert a few extra bytes (Padding and reqFlags, according to wireshark) into the security blob within the Session Setup AndX Request packet, bytes whose start tag is 0xa1, in a spot where Samba's parser expects 0xa2. The critical

Hallo everybody, I'm wondering whether it might be possible to speed up the following code: Error<-rnorm(10000000, mean=0, sd=0.05) estimate<-(log(1.1)-Error) DCF_korrigiert<-(1/(exp(1/(exp(0.5*(-estimate)^2/(0.05^2))*sqrt(2*pi/(0.05^2))*(1-pnorm(0,((-estimate)/(0.05^2)),sqrt(1/(0.05^2))))))-1)) D<-100000 Delta_ln<-rep(0,D) for(i in 1:D)

Hi All, I'm posting this just in case someone can tell what's going on with samba that would prevent this from working. Cisco has the ability to see a smb share from their webvpn product with CIFS. We can browse windows shares but not samba shares. The following log outputs are from my ASA firewall. I know these are cisco logs but I'm hoping a lightbulb will come on for someone. The

Dear Sirs. It seems to me a never ending story. We run a box with a TYAN Thunder 2500 Dual SMP mainboard, 2GB ECC Tyan certified memory, AMI Enterprise 1600 RAID adapter and additional Intel 1000/Pro server type (64 bit) GBit LAN NIC. With FreeBSD 4.8 this was stable, but to achive this state was really hard! It is a story similar to that what happend when we changed towards FreeBSD

Signed-off-by: Scott Seago <sseago at redhat.com> --- AUTHORS | 17 ++++++ README | 10 +++ conf/ovirt-agent | 12 ++++ conf/ovirt-db-omatic | 12 ++++ conf/ovirt-host-browser | 12 ++++

Hello list. I'm trying to rebuild the 2.6.9.67.0.20.EL kernel, but it fails even without modifications. How did I try it? Created a (non-root) build environment (not a mock ) Installed the kernel.scr.rpm and did a rpmbuild -ba --target=`uname -m` kernel-2.6.spec 2> prep-err.log | tee prep-out.log The build failed at the end: Processing files: kernel-xenU-devel-2.6.9-67.0.20.EL Checking