Displaying 20 results from an estimated 100 matches similar to: "rsync: readdir(.): Bad file descriptor (9)"
2009 Apr 23
1
Accessing all the first sub-elements of a list of list
Hello,
 
The 179th and 180th elements of my list of lists look like this:
 
[[179]]
[[179]]$desc
[1] ">ipi|IPI00646510|IPI00646510.2 ISOFORM P60-HCK OF TYROSINE-PROTEIN
KINASE HCK."
 
[[179]]$seq
[1]
"MGGRSSCEDPGCPRDEERAPRMGCMKSKFLQVGGNTFSKTETSASPHCPVYVPDPTSTIKPGPNSHNSNTP
GIREAGSEDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVDSLETEE
2015 Nov 19
0
Re: [PATCH] v2v: virtio-win: include *.dll too
----- Original Message -----
> From: "Amnon Ilan" <ailan@redhat.com>
> To: "Vadim Rozenfeld" <vrozenfe@redhat.com>, "Li Jin" <lijin@redhat.com>
> Cc: "Richard W.M. Jones" <rjones@redhat.com>, "Roman Kagan" <rkagan@virtuozzo.com>, libguestfs@redhat.com, "Jeff
> Nelson" <jenelson@redhat.com>,
2015 Nov 19
2
Re: [PATCH] v2v: virtio-win: include *.dll too
On Wed, Nov 18, 2015 at 11:31:17PM -0500, Li Jin wrote:
> > > > In any case the *.inf files don't seem to have any distinguishing
> > > > feature which would allow us to check this.
> > > > 
> > > > Maybe this doesn't matter?
> > > 
> > > Let me explain how it works:
> > > We don't make any difference between
2005 Aug 27
2
I want to use a ram disk as / after network booting.
Hi
 
I am an engineer who is making communication systems.
I have a board(made by Kontron ltd, Intel CPU, currently with diskless )
that is used in compactPCI.
I boot that board with network PXELINUX method and currently using NFS.
But I don't want to use NFS and I want to make and use ram disk image.
That means I want to use a ram disk as /.
Currently I made a initrd by ltsp_initrd_kit.
What
2005 Jul 18
2
scriptaculous dragdrop.js empty list problem
Hi,
I''ve just been having a look at the scriptaculous drag-n-drop library, which
looks exceedingly good. I''m running across a show-stopper here, though -
something that''s cropping up in both the online demos and my own test scripts. If
I set up two lists so that I can drag items between them, then if either list
becomes empty, I can''t drag elements back into
2016 Mar 17
0
xen_4.4.1-9+deb8u4_amd64.changes ACCEPTED into proposed-updates->stable-new
Mapping stable-security to proposed-updates.
Accepted:
-----BEGIN PGP SIGNED MESSAGE-----
Hash: SHA256
Format: 1.8
Date: Tue, 15 Mar 2016 22:18:35 +0100
Source: xen
Binary: libxen-4.4 libxenstore3.0 libxen-dev xenstore-utils xen-utils-common xen-utils-4.4 xen-hypervisor-4.4-amd64 xen-system-amd64 xen-hypervisor-4.4-arm64 xen-system-arm64 xen-hypervisor-4.4-armhf xen-system-armhf
Architecture:
2016 Mar 18
0
xen_4.4.1-9+deb8u4_amd64.changes ACCEPTED into proposed-updates->stable-new, proposed-updates
Accepted:
-----BEGIN PGP SIGNED MESSAGE-----
Hash: SHA256
Format: 1.8
Date: Tue, 15 Mar 2016 22:18:35 +0100
Source: xen
Binary: libxen-4.4 libxenstore3.0 libxen-dev xenstore-utils xen-utils-common xen-utils-4.4 xen-hypervisor-4.4-amd64 xen-system-amd64 xen-hypervisor-4.4-arm64 xen-system-arm64 xen-hypervisor-4.4-armhf xen-system-armhf
Architecture: source all amd64
Version: 4.4.1-9+deb8u4
2005 Aug 26
1
i want to use ram disk image.
Hello
 
I have a question.
I am an engineer who is making communication systems.
I have a board(made by Kontron ltd, Intel CPU, currently with diskless )
that is used in compactPCI.
I boot that board with network PXELINUX method and currently using NFS.
But I don't want to use NFS.
NFS is only needed for getting kernel and initrd.
I don't want to use NFS after booting and I want to make
2005 Jul 18
1
fix for scriptaculous dragdrop.js empty list problem
Hi Thomas,
Here''s a fix for the problem that I raised this morning, turned out to be fairly
simple in the end (after many false starts and thrashing about - thank goodness
for Venkman!)
First, in Sortable.create(), I register the parent element (the UL tag or
whatever), and add an extra property to it to mark it as the parent of the list
in question:
    for (var i = 0; i <
2008 Dec 05
0
resync onnv_105 partial for 6713916
Author: Darren Moffat <Darren.Moffat at Sun.COM>
Repository: /hg/zfs-crypto/gate
Latest revision: 957d30a3607ed9f3cbe490da5894d1e1b2104033
Total changesets: 28
Log message:
resync onnv_105 partial for 6713916
Files:
	usr/src/Makefile.lint
	usr/src/Targetdirs
	usr/src/cmd/Makefile
	usr/src/cmd/Makefile.cmd
	usr/src/cmd/acctadm/Makefile
	usr/src/cmd/acctadm/acctadm.xcl
2015 Nov 18
2
Re: [PATCH] v2v: virtio-win: include *.dll too
+Li Jin
----- Original Message -----
> From: "Vadim Rozenfeld" <vrozenfe@redhat.com>
> To: "Richard W.M. Jones" <rjones@redhat.com>
> Cc: "Roman Kagan" <rkagan@virtuozzo.com>, libguestfs@redhat.com, "Amnon Ilan" <ailan@redhat.com>, "Jeff Nelson"
> <jenelson@redhat.com>, "Yan Vugenfirer"
2013 Jun 23
1
2SLS / TSLS / SEM non-linear
Dear all, I try to conduct a SEM / two stage least squares regression with
the following equations: 
First: X ~ IV1 + IV2 * Y
Second: Y ~ a + b X
therein, IV1 and IV2 are the two instruments I would like to use.  the
structure I would like to maintain as the model is derived from economic
theory. My problem here is that I have trouble solving the equations to get
the reduced form so I can run
2011 Apr 29
4
plot several histograms with same y-axes scaling using hist()
Dear all
Problem: hist()-function, scale = ?percent?
I want to generate histograms for changing underlying data. In order to make
them comparable, I want to fix the y-axis (vertical-axis) to, e.g., 0%, 10%,
20%, 30% as well as to fix the spaces, too. So the y-axis in each histogram
should be identical. Currently, I have 100 histograms and the y-axis scales
changes in each. 
Here is my code:
2004 Jan 16
0
Rsync and windows sharing
Hi,
I search a way to do rsync on a window share without mount the share. 
Why ? because i don't want to run my script as root for mount and unmount the 
share. (it's bad to run scripts as root :-) )
Alternative way is to install rsync on cygwin@windows, but i can't because 
windows computer are not mine.
Why rsync (made by the creator of Samba) can't read a window share ?
2008 Aug 05
2
Leopard Macs using Kerberos: Failed to parse negTokenTarg
I think I've found out why MacOS 10.5.x (Leopard) clients are unable to
connect to Samba shares when authenticating with Kerberos. Basically,  
the
Leopard Macs insert a few extra bytes (Padding and reqFlags,  
according to
wireshark) into the security blob within the Session Setup AndX Request
packet, bytes whose start tag is 0xa1, in a spot where Samba's parser
expects 0xa2. The critical
2011 Apr 28
3
Speed up code with for() loop
Hallo everybody,
I'm wondering whether it might be possible to speed up the following code:
Error<-rnorm(10000000, mean=0, sd=0.05)
estimate<-(log(1.1)-Error)
DCF_korrigiert<-(1/(exp(1/(exp(0.5*(-estimate)^2/(0.05^2))*sqrt(2*pi/(0.05^2))*(1-pnorm(0,((-estimate)/(0.05^2)),sqrt(1/(0.05^2))))))-1))
D<-100000
Delta_ln<-rep(0,D)
for(i in 1:D)
2007 Feb 04
0
Samba and Cisco's WebVPN
Hi All,
I'm posting this just in case someone can tell what's going on with
samba that would prevent this from working. Cisco has the ability to
see a smb share from their webvpn product with CIFS. We can browse
windows shares but not samba shares. The following log outputs are
from my ASA firewall. I know these are cisco logs but I'm hoping a
lightbulb will come on for someone. The
2003 Aug 13
6
5.1-R-p2 crashes on SMP with AMI RAID and Intel 1000/Pro
Dear Sirs.
It seems to me a never ending story. We run a box with a TYAN Thunder
2500 Dual SMP mainboard, 2GB ECC Tyan certified memory, AMI Enterprise
1600 RAID adapter and additional Intel 1000/Pro server type (64 bit)
GBit LAN NIC. With FreeBSD 4.8 this was stable, but to achive this
state was really hard! It is a story similar to that what happend when
we changed towards FreeBSD
2009 Jul 23
1
[PATCH server] changes required for fedora rawhide inclusion.
Signed-off-by: Scott Seago <sseago at redhat.com>
---
 AUTHORS                                            |   17 ++++++
 README                                             |   10 +++
 conf/ovirt-agent                                   |   12 ++++
 conf/ovirt-db-omatic                               |   12 ++++
 conf/ovirt-host-browser                            |   12 ++++
2008 Jun 30
4
Rebuild of kernel 2.6.9-67.0.20.EL failure
Hello list.
I'm trying to rebuild the 2.6.9.67.0.20.EL kernel, but it fails even without 
modifications.
How did I try it?
Created a (non-root) build environment (not a mock )
Installed the kernel.scr.rpm and did a
rpmbuild -ba --target=`uname -m` kernel-2.6.spec 2> prep-err.log | tee 
prep-out.log
The build failed at the end:
Processing files: kernel-xenU-devel-2.6.9-67.0.20.EL
Checking