similar to: Preserving groups

Hi all! I''ve got 2 (soon 3) internet connection. 1 - via ADSL, 2(and3) via ppp My network: http://desima.objectis.net/network-diag linux1: user1.user2 eth0=192.168.1.1 ppp0=192.168.5.2( gw 192.168.5.1) gw=192.168.1.2 ( thru ADSL) compA=192.168.1.6 compB=192.168.1.15 gw2=192.168.1.217 via ppp to different ISP All works for compA and CompB, user1 should use default gw(192.168.1.2)

Hi all, I'm setting up a local LDAP server with a pass-through authentication to another LDAP. I'm not clear about the encryption. Say the case is like this. CompB is set to have LDAP authentication. A ---> SSH ---> CompB ---> Local LDAP:389 ---> SASLAUTHD --> Global LDAP: 636 1. Password on the SSH session would be encrypted, isn't it? 2. How about when it goes to the

hello, i have a problem with wine, but i don't know the meaning of the message that it replays when i try to start the prog .exe. This is the message: Code: ... wine: Unhandled page fault on read access to 0xd12e3930 at address 0x41654d (thread 0009), starting debugger... Unhandled exception: page fault on read access to 0xd12e3930 in 32-bit code (0x0041654d).

Hi!, I'm really hoping someone out there will be able to help me. I recently started my MSc dissertation on Population Projection Matrices, which has been going well until now. I am trying to set-up a general script that does a pairwise comparison of all elements in my matrices. So for example, given that I have the following matrix S: > S [,1] [,2] [,3] [1,]

Dear list exist a function or package in R for Granger or Johanson causality test thanks in advance Rafael Gutierrez Estad?stico Unidad de Tecnolog?a Cerro Matoso S.A. Ext. 3350 "Este correo y sus anexos pueden ser confidenciales y estar protegidos por derechos de autor. Est?n dirigidos ?nica y exclusivamente para uso de el (los) destinatario(s). Si Usted por error lo ha recibido por

We have AIX 4.3.3 ML09 and AIX 5.1 ML01 I have narrowed the problem down, it is nothing to do with uni/multiprocessor machines. Both rsync 2.3.1 compiled by Bull in an installp and a gcc compiled version of 2.4.5 ( by me ) both have exactly the same problem with SSH 3.1.p1 and both DONT have the problem with SSH 2.9.9p1 - so I assume this is something highly specific to SSH 3.1.1.p1 Hope this

Thank you for posting the doco link, Jordan! The first thing I read is that, for Windows ? it only runs on: * Windows Vista * Windows 7 * Windows 8. Which is a problem ? as I am running Windows 10. ? Are you able to confirm which of the following statements is true: 1. The doco hasn?t been updated ? it does run on W10, or 2. W10 is indeed not supported? Thanks, Andrew

According to the doco, "winbind nss info = template sfu" requires "idmap backend = idmap_ad" which has been depreciated to "idmap backend = ad" but, [2006/05/30 13:43:23, 1] nsswitch/winbindd.c:main(953) winbindd version 3.0.23pre2-SVN-build-15864 started. Copyright The Samba Team 2000-2004 [2006/05/30 13:43:23, 0] sam/idmap.c:idmap_init(152) idmap_init:

Hi people, I've got Asterisk running nicely with two 7960s and hooked into our MD110 via a cisco AS5300. All is wonderful with the world...except, what is the deal with features like group pickup and so on... I have no idea what codes are available, what they do, etc...is there either a standard * is conforming to, or some doco of what features are available? (heh, yeah

Bugzilla doesn't appear to send new bugs to openssh-unix-dev as Damien said he wanted it to, so I'm forwarding the message I got back. - Dave Dykstra ----- Forwarded message from bugzilla-daemon at mindrot.org ----- From: bugzilla-daemon at mindrot.org To: dwd at bell-labs.com Subject: [Bug 11] New: no reference to bugzilla on openssh home page Date: Sat, 10 Nov 2001 03:55:32 +1100

Hi compa~eros, some one help me please, i use a voip software, its an special software for a service in D.R, i can run this perfect in v.0.9.56 but not in the V.1.-- :? this is the explanation program page: http://nuevositio.tricom.net/lineas+virtuales.aspx (in spanish) an the download link is: https://canales.tricom.net/lineasip/descargas.asp please help me, thanks

Hello, The 179th and 180th elements of my list of lists look like this: [[179]] [[179]]$desc [1] ">ipi|IPI00646510|IPI00646510.2 ISOFORM P60-HCK OF TYROSINE-PROTEIN KINASE HCK." [[179]]$seq [1] "MGGRSSCEDPGCPRDEERAPRMGCMKSKFLQVGGNTFSKTETSASPHCPVYVPDPTSTIKPGPNSHNSNTP GIREAGSEDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVDSLETEE

Rsync release 2.5.6 is now available at http://ftp.samba.org/ftp/rsync/rsync-2.5.6.tar.gz ftp://ftp.samba.org/pub/rsync/rsync-2.5.6.tar.gz rsync://ftp.samba.org/ftp/rsync/rsync-2.5.6.tar.gz There is a '.sig' file at corresponding URLs with a gpg signature; the public key is available on the pgp keyservers. NEWS for rsync version 2.5.6, aka the dwd-between-jobs release Changes

The second rsync-2.5.6 pre-release version is now available at: http://rsync.samba.org/ftp/rsync/preview/rsync-2.5.6pre2.tar.gz ftp://rsync.samba.org/pub/rsync/preview/rsync-2.5.6pre2.tar.gz rsync://rsync.samba.org/ftp/rsync/preview/rsync-2.5.6pre2.tar.gz There's also a corresponding '.sig' file that contains a gpg signature of the file; the public key is available on the

Hi all, I am working wit a Mandriva 2007 and have installed the asterisk svn 1.4 with success. I also used the patch for cellphones and it works perfectly. I was that happy that I decided to buy a TDM11B and it works. Now, I want to study a bit the code used by this people. Does anybody know how can I go deeper in this code with funcitonal bloqs in order to understand how is possible to

Hi, What is the normal mechanism for creating the tables in the (a) test and (b) production databases. For example the following didn''t work for creating the production tables: a) change environment.rb to include "ENV[''RAILS_ENV''] ||= ''production''" b) run "rake db:migrate" However this seemed to still work against DEV not

Hi all, I have just discovered docos for rpcclient in 2.2.1a, and it appears that a solution for installing printer drivers on my Samba server may be in-hand. I am furiously reading man rpcclient and experimenting and with any luck, this will bear fruit. I have to date been unable to use the NT Add Printer Wizard to upload drivers and I believe the reason is that in our particular

Hi, I do not get how par works, help please. Let's say I have a simple plot: plot(1:10) I want to change the font size for the x axis... how do I do that? Thank you, Stephane -- The Wellcome Trust Sanger Institute is operated by Genome Research Limited, a charity registered in England with number 1021457 and a compa ny registered in England with number 2742969,

Dear R-Help i have a newbie question, how edit size fonts and colors in the plots (scatter.acm or dudi.acm function) of multiple correspondence analysis in the ADE4 Package? thanks? Rafael Gutierrez Estad??stico Unidad de Tecnolog??a Cerro Matoso S.A. Tel. 4-7723350 Fax. 4-7723236 ************************************************************************************************* Este correo

Hi, I need a script which makes the package compa??o rpm's through two text files ... Since a file is the output of the command *rpm-qa > pkg.out * And the second file is a list of several packages rpm's, multiple versions and architectures. My idea is to compare a package *x* file pkg.out with several packages *y* of the file update.out and know