similar to: openssh-4.7p1 & RemoteForward to openssh-3.6.1p2 Disconnecting: Bad, packet length

Hi, I've just upgraded to openssh-4.7p1 on my gentoo box, and I've noticed a incompatibility with openssh-3.6.1p2 running on a redhat AS3 server. If I ssh from my openssh-4.7_p1 client to the openssh-3.6.1p2 server, and RemoteForward a port, the ssh connection closes if I try to send more than roughly 300K through the tunneled port. The problem isn't present when I use openssh-4.6p1

Hi - If I have a hypothetical distribution as an array distribution<-c(0,1,2,3,4,5,6,7,8,9) and I want to find the probability there is a value smaller than a new value. new_value<-4 (such that I'd get this type of output) new_value p-value 4 0.5 3.4 0.4 3 0.4 0 0.1 -1 0.0 Thanks for the help, I bet this is really easy... :/ Stephen -- The Wellcome Trust Sanger Institute is

Hello, The 179th and 180th elements of my list of lists look like this: [[179]] [[179]]$desc [1] ">ipi|IPI00646510|IPI00646510.2 ISOFORM P60-HCK OF TYROSINE-PROTEIN KINASE HCK." [[179]]$seq [1] "MGGRSSCEDPGCPRDEERAPRMGCMKSKFLQVGGNTFSKTETSASPHCPVYVPDPTSTIKPGPNSHNSNTP GIREAGSEDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVDSLETEE

Hi R friends, I've been attempting to create plots with multiple alpha values using Cairo to save them on a windows (32b XP) platform as it doesn't support more than 3 alpha values. This worked well until I wanted a postscript file (unsupported) and as a attempted work around I installed RGtk2. So far so good, however now when I try to use a >CairoPDF("alpha.pdf", 6, 6,

Specifying a RemoteForward of 0:example.com:1234 dynamically allocates the listen port on the server, and then reports it to ... the client! Where it is practically useless. Was this someone's idea of a joke? Presumably not--there are some technical obstacles to reporting it to the remote process. I'd like to help solve that problem. The natural way to me would be to extend the syntax

http://bugzilla.mindrot.org/show_bug.cgi?id=1000 dtucker at zip.com.au changed: What |Removed |Added ---------------------------------------------------------------------------- Status|RESOLVED |CLOSED ------- Comment #5 from dtucker at zip.com.au 2006-10-07 11:39 ------- Change all RESOLVED bug to CLOSED with the exception

HI, this is my problem I want to subset this file df, using only unique df$exon printing the line once even if df$exon appear several times: unique(df$exon) will show me the unique exons If I try to print only the unique exon lines with df[unique(df$exon),] -this doesn't print only the unique ones :( could you help? thanks Nat exon size chr start

Hi, I'm trying to get a plot ready for publication, which involves getting it to look nice at a rather small size and to fine-tune positioning all the labels and sizes of the margins. I realise that I may not be doing this the right way and I welcome any comments about better approaches to do this. What I have done so far is open an X11 device with the size I want for the final output and I

On 16/12/14 16:30, Matthias Egger wrote: > What happened: > A few weeks ago one of the LDAPS Servers which is not maintained by us > has crashed. From that moment on, users could still login to check their > emails, but they were not able to send any email through postfix (which > uses smtpd_sasl_type = dovecot) > > What i do not understand, is why did dovecot not switch to

Hello Please find bug report attached. Thanks Matthew -- Matthew Gillman Team 105: Variation Informatics Wellcome Trust Sanger Institute, Wellcome Trust Genome Campus, Hinxton, Cambridge, CB10 1SA, UK Tel: 01223 834244 Ext. 4922 -- The Wellcome Trust Sanger Institute is operated by Genome Research Limited, a charity registered in England with number 1021457 and a company registered

DeaR developers, I was recently moving with my laptop between two environments with and without a HTTP proxy server. As the internal proxy configuration is read only once from the environment variables http_proxy/HTTP_PROXY at the first call of download.file(), the proxy configurations couldn't be adjusted at a later stage. (See also the comment in ?download.file). This caused some

Hello - I am trying to figure out R's transformation for interaction terms in a linear regression. My simple background understanding is that interaction terms are generally calculated by multiplying the centred (0-mean) variables with each other and then doing the regression. However, in this regard I would have expected to see the same p-value when I calculate summary(lm(Y~A:B)) for A:B

Hi, I do not get how par works, help please. Let's say I have a simple plot: plot(1:10) I want to change the font size for the x axis... how do I do that? Thank you, Stephane -- The Wellcome Trust Sanger Institute is operated by Genome Research Limited, a charity registered in England with number 1021457 and a compa ny registered in England with number 2742969,

Hi I hope someone can shed some light on this: For some reason when I read.table("bfx.txt") R decides to only give back the first character from each column in each row as one single column. Like this: V1 1 ÿþr 2 \n 3 r 4 1 5 0 6 A 7 G 8 \n 9 r 10 1 11 0 12 T 13 C 14 \n The data should be:

Hello, I have a question about using extreme value distribution in R. I have two variables, X and Y, and have pairs of points (X1,Y1),(X2,Y2), (X3,Y3) etc. When I plot X against Y, it looks like the maximum value of Y (for a particular X) is correlated with X. Indeed, when I bin the data by X-value into equally sized bins, and test whether the maximum value of Y for a bin is correlated with

First, apologies for no example data but I don't think it's needed in this case, Q: Can (and if so how ) the line end style be changed for 'cloud' plots? I've tried par(lend=2), trellis.par.set(add.line = list(lend=2)) and much googling but to no avail Thanks in advance Dan P.S. the reason for this is that the round end looks bad at lwd=3 or more Daniel Alcock Malaria

Hello folks, I have a problem with replication and mail_location with LAYOUT=fs set. If I set "mail_location = maildir:~/mail" (leaving out the :LAYOUT=fs), create and populate some mailboxes and subfolders, they all get replicated. If I start with a clean mail spool and LAYOUT=fs, I can create some new mailboxes and subfolders but only the inbox is replicated. Subfolders are ignored.

Hi everybody, I've been looking around, but can't seem to find the answer. I get a list of names (which vary, so I never know them in advance), and transform them into variables, each of which is a dataframe, using assign: polyList <- c("rs123", "rs124", "rs555", "rs000") numPoly <- length(polyList) for (k in 1:numPoly) {

HI, I would like to update my DESeq package version on R-2-14 using bioclite() and get this message, could somebody help please? > biocLite("DESeq") BioC_mirror: 'http://www.bioconductor.org' Using R version 2.14, BiocInstaller version 1.2.1. Installing package(s) 'DESeq' Installing package(s) into ?/nfs/team82/nac/R-modules? (as ?lib? is unspecified) trying URL

Dear All, Apologies for sending this email to both list, but at this point I'm not sure which one could help me the most. I have 4 sets of data, 1 test and 3 different sets of controls. The measurements are binary, with a matrix of 0 and 1 I'm measuring across time (rows, ~815) the behaviour of organelles in the cell by microscopy in response to different stimuli (several measurements