similar to: plot several histograms with same y-axes scaling using hist()

Hi all, I am using "lm" to fit some anova factor models with interactions. The default setting for my unordered factors is "treatment". I understand the resultant "lm" coefficients for one factors, but when it comes to the interaction term, I got confused. > options()$contrasts unordered ordered "contr.treatment"

Hello, The 179th and 180th elements of my list of lists look like this: [[179]] [[179]]$desc [1] ">ipi|IPI00646510|IPI00646510.2 ISOFORM P60-HCK OF TYROSINE-PROTEIN KINASE HCK." [[179]]$seq [1] "MGGRSSCEDPGCPRDEERAPRMGCMKSKFLQVGGNTFSKTETSASPHCPVYVPDPTSTIKPGPNSHNSNTP GIREAGSEDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVDSLETEE

+Li Jin ----- Original Message ----- > From: "Vadim Rozenfeld" <vrozenfe@redhat.com> > To: "Richard W.M. Jones" <rjones@redhat.com> > Cc: "Roman Kagan" <rkagan@virtuozzo.com>, libguestfs@redhat.com, "Amnon Ilan" <ailan@redhat.com>, "Jeff Nelson" > <jenelson@redhat.com>, "Yan Vugenfirer"

Dear all, I try to conduct a SEM / two stage least squares regression with the following equations: First: X ~ IV1 + IV2 * Y Second: Y ~ a + b X therein, IV1 and IV2 are the two instruments I would like to use. the structure I would like to maintain as the model is derived from economic theory. My problem here is that I have trouble solving the equations to get the reduced form so I can run

Hi All, I have a whole lot of *.raw files in my working folder and I am doing the same analysis on each of those and want to save all the results in a single file. I am making some mistake here and can't figure out how to solve it. Say, the *.raw files are ABCD.raw, EFGH.raw, IJKL.raw ... The files are of this format ID PHI?? aa1? aa2? aa3 .... 1??? 1???? 1.3?? 2.0?? 1.0 2??? 0????

Hi there, I have two questions on matrix manipulation. For the first one, I want to calculate the product of each column of a matrix (say A) with another vector (say b). That is, if A has 5 columns (a1, a2, a3, a4, a5), I want to obtain a matrix with columns (a1*b, a2*b, aA3*b, a4*b, a5*b). Can I do it directly, without using "for" loop? For the second one, I have a matrix A of

Hi List, As the subject states, I'm running a CTDB cluster. Samba is Sernet 4.4.5 in an NT-Style Samba domain (DCs are Centos 6 packaged samba, 3.6.22) Every so often, users are unable to connect to network shares. Most of the problems seem to happen on Windows 7 domain members, but smbclient will also fail to connect. I see these lines in the logs for every attempted connection:

Hi I am an engineer who is making communication systems. I have a board(made by Kontron ltd, Intel CPU, currently with diskless ) that is used in compactPCI. I boot that board with network PXELINUX method and currently using NFS. But I don't want to use NFS and I want to make and use ram disk image. That means I want to use a ram disk as /. Currently I made a initrd by ltsp_initrd_kit. What

Hi, I''ve just been having a look at the scriptaculous drag-n-drop library, which looks exceedingly good. I''m running across a show-stopper here, though - something that''s cropping up in both the online demos and my own test scripts. If I set up two lists so that I can drag items between them, then if either list becomes empty, I can''t drag elements back into

Here is another occurrence of wmTSA internal error. My time series is a short breathing cycle (2425-Cyle_9.txt). Since wmtsa functions that extract extrema seem to expect longer series than I have, I tried the folowing two tricks: 1) I prolong the 1-cycle series on both ends through duplicating the first value (on the left end( and the last value on the right end as any ties as the 1-cycle

Hallo everybody, I'm wondering whether it might be possible to speed up the following code: Error<-rnorm(10000000, mean=0, sd=0.05) estimate<-(log(1.1)-Error) DCF_korrigiert<-(1/(exp(1/(exp(0.5*(-estimate)^2/(0.05^2))*sqrt(2*pi/(0.05^2))*(1-pnorm(0,((-estimate)/(0.05^2)),sqrt(1/(0.05^2))))))-1)) D<-100000 Delta_ln<-rep(0,D) for(i in 1:D)

R-experts, I have a bunch of files (by date) that I can read into dataframes as below. df$today: identifier rtgmdy rtgmdy_dt rtgmdy_watch rtgmdy_nowatch rtgmdy_watch_dt rtgsp rtgsp_dt 310000031 Aa3 20050701 Aa3 NA AA- 20050510 310000086 B1 20070920 B1 NA B+ 20070828 310000106 Baa2 20040326 Baa2 NA BBB 20051003 310000170 Baa3 20070601 Baa3 NA BBB+ 20051024 310000225 Ba2 20070601 Ba2 NA

Hi, I've spent the better part of three weeks tracking into this problem. I hope you don't mind a post here on smbfs, but I was hoping someone might have some insight or ideas on where to look next. Summary: trying to rsync folders across an smb mounted share with EXACTLY 50 objects (folder or files), results in the error rsync: readdir(.): Bad file descriptor (9) Details The problem

----- Original Message ----- > From: "Amnon Ilan" <ailan@redhat.com> > To: "Vadim Rozenfeld" <vrozenfe@redhat.com>, "Li Jin" <lijin@redhat.com> > Cc: "Richard W.M. Jones" <rjones@redhat.com>, "Roman Kagan" <rkagan@virtuozzo.com>, libguestfs@redhat.com, "Jeff > Nelson" <jenelson@redhat.com>,

On Wed, Nov 18, 2015 at 11:31:17PM -0500, Li Jin wrote: > > > > In any case the *.inf files don't seem to have any distinguishing > > > > feature which would allow us to check this. > > > > > > > > Maybe this doesn't matter? > > > > > > Let me explain how it works: > > > We don't make any difference between

On Thu, 22 Sep 2016 10:58:18 +0100 Alex Crow via samba <samba at lists.samba.org> wrote: > Hi List, > > As the subject states, I'm running a CTDB cluster. Samba is Sernet > 4.4.5 in an NT-Style Samba domain (DCs are Centos 6 packaged samba, > 3.6.22) > > Every so often, users are unable to connect to network shares. Most of > the problems seem to happen on

Hello I have a question. I am an engineer who is making communication systems. I have a board(made by Kontron ltd, Intel CPU, currently with diskless ) that is used in compactPCI. I boot that board with network PXELINUX method and currently using NFS. But I don't want to use NFS. NFS is only needed for getting kernel and initrd. I don't want to use NFS after booting and I want to make

Hi Thomas, Here''s a fix for the problem that I raised this morning, turned out to be fairly simple in the end (after many false starts and thrashing about - thank goodness for Venkman!) First, in Sortable.create(), I register the parent element (the UL tag or whatever), and add an extra property to it to mark it as the parent of the list in question: for (var i = 0; i <

Ok, now we have the mapping of color names to color codes (see below) and conversion to rgb (something like Ben Bolker's function), but how to convert rgb to hsv? Thanks to Brian Ripley, Peter Dalgaard and Ben Bolker Details below Regards Jens etc/colors.big maps 455 names to rgb in S syntax etc/rgb.txt maps 657 names to rgb in C syntax, but unlike colors() it has mixed upper and

I have 2 Ubuntu 12.04/samba 4 servers acting as DCs for my Domain. I provisioned the Domain by using the classicupgrade (prior authentication was LDAP+Samba). I have added some new test users. I also have two files servers. One is running RHEL 5.9/Samba 3, the other Ubuntu 12.04/Samba 4. Users that have their home directories and profiles stored on the RHEL5.9/Samba 3 fileserver work correctly.