similar to: Looking for example of usage of function unz

Hi Sorry, I am clearly missing something here. I want to read this file directly: ftp://ftp.sanger.ac.uk/pub/mirbase/targets/v5/arch.v5.txt.gallus_gallus. zip I tried using read.table(gzfile("ftp://ftp.sanger.ac.uk/pub/mirbase/targets/v5/arch.v5 .txt.gallus_gallus.zip")) But I got an error: Error in open.connection(file, "r") : cannot open the connection In addition:

I get unexpected behavior from "readLines()" and "scan()" depending on how the file is opened with "gzfile" or "unz". More specifically: > file <- gzfile("file.gz") > readLines(file,1) [1] "a\tb\tc" > readLines(file,1) [1] "a\tb\tc" > close(file) It seems that the stream is rewound between calls to readLines.

Hi, you could use "scan" instead, it seems to work fine also when wrapped around "unz". Or, alternatively, you could use "unzip" instead of "unz". It works as expected, i.e. reads the last incomplete line and throws a warning about this. So it seems to me that "unz" creates a non-blocking connection, whereas "unzip" creates a

I am having problems getting the unz() function to work as a connection to start reading a file... z <- unz("c:/temp/stoxx.zip", "close_tmi_components.txt", "r") readLines(z,2) yields the following problems: > z <- unz("c:/temp/stoxx.zip", "close_tmi_components.txt", "r") Error in unz("c:/temp/stoxx.zip",

Hi again, The unz connection is non-blocking by default. I checked do_unz which calls R_newunz which calls init_con and the only place in any of those functions that sets 'blocking' is init_con which sets it to FALSE: https://github.com/wch/r-source/blob/0c26529e807a9b1dd65f7324958c17bf72e1de1a/src/main/connections.c#L713 I'll open an issue on R-bugzilla and see if they're

Dear list, I'm seeing a strange interaction with readLines() and unz() when reading a file without an empty final line. The final line gets dropped silently: > cat("hello", file = "hello.txt") > zip("hello.zip", "hello.txt") adding: hello.txt (stored 0%) > readLines(unz("hello.zip", "hello.txt")) character(0) The

But note: > zip("hello.zip", "hello.txt") updating: hello.txt (stored 0%) > readChar(unz("hello.zip","hello.txt"),100) [1] "hello" I leave it to you and other wiser heads to figure out. Cheers, Bert On Thu, Oct 24, 2024 at 8:57?AM Iris Simmons <ikwsimmo at gmail.com> wrote: > Hi Mikko, > > > I tried running a few

Dear List, Does somebody know how to get the filename lists in the ziped when "gzfile" or "unz" command is used ? Thanks for your help. Shawn Lee -- The information contained in this communication and any atta...{{dropped}}

Not sure this is a bug in R. Maybe its a bug in my understanding of unz(). The character 'b2' (hexadecimal) is in position 535 of line 1 of 'naughty.csv'. This character appears as superscript '2' and came to me in an EXCEL file that I converted to text in a comma separated ( *.csv ) format. The first line gets truncated by readLines after 534 characters using unz():

Hi, I have downloaded a bunch of bz2 files. I wonder if R will be able to unzip them in a batch mode or even one at a time? I was looking at the unz function. But it didn't work well. Say I have a bz2 file in H:/Temp/65502805_532.pair.bz2. Anyone has any suggestion? thanks John > setwd("H:\\Temp\\") > getwd() [1] "H:/Temp" >

Hi! I'm trying to read individual files from a ZIP archive, using the unz() function. Some of the files contain non-ASCII characters and I'd like to avoid unpacking them in a temporary directory. My problem is that unz() seems to ignore the encoding="latin1" option I need to read the non-ASCII characters properly. I can't find a clear indication in the documentation that

Hi R friends, I've been attempting to create plots with multiple alpha values using Cairo to save them on a windows (32b XP) platform as it doesn't support more than 3 alpha values. This worked well until I wanted a postscript file (unsupported) and as a attempted work around I installed RGtk2. So far so good, however now when I try to use a >CairoPDF("alpha.pdf", 6, 6,

Hi Reading the help for ?unz I was wondering if I can read data into R from within an zipfile that is on some website, like maybe: dtaa = read.table(unz("http://www.ats.ucla.edu/stat/examples/alsm/alsm.zip","Ch01pr19.dat")) Thanks for letting me know if you came acros such a thing before. Toby

Hello all, I've got Unz (FM Towns emulator) running under wine but its not capable of reading the original FM Towns CDROM images on my Mac. I have it working under Windows XP using Daemon Tools to mount the ISO but under OSX it does not work. I have the ISO mounted under finder and have pointed my wine configuration to the mount point. No luck. Has anyone successfully got this running under

Hi List I have a series of zip archives each containing several files. One of these files is called goCats.txt and I would like to read it into R from the archive. It's a simple tab delimited text file. pathToZip <- '/home/iain/Documents/Work/Results/bovineMacRNAData/deAnalysis/afInfection/commonNorm/twoHrs/af2hrs.zip' z <- unz(pathToZip, 'goCats.txt', 'r') zT

HI, this is my problem I want to subset this file df, using only unique df$exon printing the line once even if df$exon appear several times: unique(df$exon) will show me the unique exons If I try to print only the unique exon lines with df[unique(df$exon),] -this doesn't print only the unique ones :( could you help? thanks Nat exon size chr start

Hi I hope someone can shed some light on this: For some reason when I read.table("bfx.txt") R decides to only give back the first character from each column in each row as one single column. Like this: V1 1 ÿþr 2 \n 3 r 4 1 5 0 6 A 7 G 8 \n 9 r 10 1 11 0 12 T 13 C 14 \n The data should be:

Hello, I have a question about using extreme value distribution in R. I have two variables, X and Y, and have pairs of points (X1,Y1),(X2,Y2), (X3,Y3) etc. When I plot X against Y, it looks like the maximum value of Y (for a particular X) is correlated with X. Indeed, when I bin the data by X-value into equally sized bins, and test whether the maximum value of Y for a bin is correlated with

Hi The cor function in the stats package calculates the correlation between columns of data, does anyone know if it is at all possible to calculate the correlation between rows instead ? Or is there an appropriate package or function that is more appropriate I'd like to calculate spearman & pearson correlations between rows. Many thanks Jason -- --------------------------------

Hello, The 179th and 180th elements of my list of lists look like this: [[179]] [[179]]$desc [1] ">ipi|IPI00646510|IPI00646510.2 ISOFORM P60-HCK OF TYROSINE-PROTEIN KINASE HCK." [[179]]$seq [1] "MGGRSSCEDPGCPRDEERAPRMGCMKSKFLQVGGNTFSKTETSASPHCPVYVPDPTSTIKPGPNSHNSNTP GIREAGSEDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVDSLETEE