similar to: need help when "make check" R-2.11.1

Jim Lemon <bitwrit <at> ozemail.com.au> writes: > I have been thinking about how to reduce the number of basic questions that > elicit the ...ahem... robust debate that has occurred about how to answer The traffic on r-help could be reduced by creating a second list where more elementary questions are asked. There may be other ways to partition the universe of questions

In postscript graphs (pointsize = 10, different sizes in graph adjusted via cex) I would like to use different font sizes but get the following warning message: Warning messages: 1: X11 used font size 8 when 9 was requested 2: X11 used font size 8 when 7 was requested 3: X11 used font size 8 when 5 was requested This is probably not a R but a X11 problem, nevertheless I would be most

Hello, I would like to compress a long string (character vector), store the compressed string in the text field of a SQLite database (using RSQLite), and then load the text back into memory and decompress it back into the the original string. My character vector can be compressed considerably using standard gzip/bzip2 compression. In theory it should be much faster for me to compress/decompress

HI, this is my problem I want to subset this file df, using only unique df$exon printing the line once even if df$exon appear several times: unique(df$exon) will show me the unique exons If I try to print only the unique exon lines with df[unique(df$exon),] -this doesn't print only the unique ones :( could you help? thanks Nat exon size chr start

I would greatly appreciate some example of correct usage of function unz. I have to download and uncompress the following web compressef file: ftp://ftp.sanger.ac.uk/pub/mirbase/targets/v5/arch.v5.txt.homo_sapiens.zip I tried the following command that does not work: Targets.rec <- readLines(zz <- unz("ftp://ftp.sanger.ac.uk/pub/mirbase/targets/v5/arch.v5.txt.homo_sapiens.zip"))

Hi R friends, I've been attempting to create plots with multiple alpha values using Cairo to save them on a windows (32b XP) platform as it doesn't support more than 3 alpha values. This worked well until I wanted a postscript file (unsupported) and as a attempted work around I installed RGtk2. So far so good, however now when I try to use a >CairoPDF("alpha.pdf", 6, 6,

Hello, I have a question about using extreme value distribution in R. I have two variables, X and Y, and have pairs of points (X1,Y1),(X2,Y2), (X3,Y3) etc. When I plot X against Y, it looks like the maximum value of Y (for a particular X) is correlated with X. Indeed, when I bin the data by X-value into equally sized bins, and test whether the maximum value of Y for a bin is correlated with

Hi Sorry, I am clearly missing something here. I want to read this file directly: ftp://ftp.sanger.ac.uk/pub/mirbase/targets/v5/arch.v5.txt.gallus_gallus. zip I tried using read.table(gzfile("ftp://ftp.sanger.ac.uk/pub/mirbase/targets/v5/arch.v5 .txt.gallus_gallus.zip")) But I got an error: Error in open.connection(file, "r") : cannot open the connection In addition:

Hi, I get the same error as mentioned in http://r.789695.n4.nabble.com/error-in-memCompress-in-make-check-td3318922.html I try to compile R 2.12.2 under Tinycore 3.5.1 running in VirtualBox 4.0.4. Since first xz was not installed I must have used the internal version which comes with the R source tar ball. But after installing the xz 5.0.0 extension the error remained. Any idea what else I

Hi everybody, I've been looking around, but can't seem to find the answer. I get a list of names (which vary, so I never know them in advance), and transform them into variables, each of which is a dataframe, using assign: polyList <- c("rs123", "rs124", "rs555", "rs000") numPoly <- length(polyList) for (k in 1:numPoly) {

Hi The cor function in the stats package calculates the correlation between columns of data, does anyone know if it is at all possible to calculate the correlation between rows instead ? Or is there an appropriate package or function that is more appropriate I'd like to calculate spearman & pearson correlations between rows. Many thanks Jason -- --------------------------------

Hello, The 179th and 180th elements of my list of lists look like this: [[179]] [[179]]$desc [1] ">ipi|IPI00646510|IPI00646510.2 ISOFORM P60-HCK OF TYROSINE-PROTEIN KINASE HCK." [[179]]$seq [1] "MGGRSSCEDPGCPRDEERAPRMGCMKSKFLQVGGNTFSKTETSASPHCPVYVPDPTSTIKPGPNSHNSNTP GIREAGSEDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVDSLETEE

Hello, I apologize for this question that may has been asked a lot of times but I could not go through it. I create a multivariate time series containing NA values. I want to compute a linear regression and obtain a time serie for both residuals and fitted values. I have tried the trick ts.intersect, without success. Could you help me out of this? #### Example: y<-ts(1:10+rnorm(10))

Hi, I do not get how par works, help please. Let's say I have a simple plot: plot(1:10) I want to change the font size for the x axis... how do I do that? Thank you, Stephane -- The Wellcome Trust Sanger Institute is operated by Genome Research Limited, a charity registered in England with number 1021457 and a compa ny registered in England with number 2742969,

Greetings! OS: Windows R 2.0.1 Before anyone flames -- I tried to query this on the R searchable web site and using google and did not find anything applicable. As of about a week ago the help.search function dies when used in the simple help.search("something") usage. The error is Error in rbind(...) : number of columns of matrices must match (see arg 203) After some effort I have

Hi, I would like some extra information on the 'cgh' package in R. I noticed that there isn't much activity regarding this package on the R and BioC mailing list (I googled it). I started using this package and I have few questions: 1/ As I have a custom tiling like array @8um features resolution (affy), I have a lot of probes to work with. I'm assuming it is correct to

Hi I hope someone can shed some light on this: For some reason when I read.table("bfx.txt") R decides to only give back the first character from each column in each row as one single column. Like this: V1 1 ÿþr 2 \n 3 r 4 1 5 0 6 A 7 G 8 \n 9 r 10 1 11 0 12 T 13 C 14 \n The data should be:

Hello, I need a specific version of R installed for consistency reasons. I do the standard setup steps: echo "deb https://cran.ma.imperial.ac.uk/bin/linux/ubuntu trusty/" | sudo tee -a /etc/apt/sources.list sudo apt-key adv --keyserver keyserver.ubuntu.com --recv-keys E084DAB9 sudo apt-get update And then a simple install call, which used to work just fine some time ago, tosses an

Hi, I'd like to get an argument (I think it's the right term) dynamically from a list, but cannot manage to do it. Here is the code I use: #output given by database BOB <- c('A/A', 'C/C', '15/27') MARY <- c('A/A', NA, '13/12') JOHN <- c('A/A', 'C/A', '154/35') CLIFF <- c('A/C', 'C/C',

First, apologies for no example data but I don't think it's needed in this case, Q: Can (and if so how ) the line end style be changed for 'cloud' plots? I've tried par(lend=2), trellis.par.set(add.line = list(lend=2)) and much googling but to no avail Thanks in advance Dan P.S. the reason for this is that the round end looks bad at lwd=3 or more Daniel Alcock Malaria