Displaying 20 results from an estimated 300 matches similar to: "need help when "make check" R-2.11.1"
2004 Dec 02
7
A possible way to reduce basic questions
Jim Lemon <bitwrit <at> ozemail.com.au> writes:
> I have been thinking about how to reduce the number of basic questions that
> elicit the ...ahem... robust debate that has occurred about how to answer
The traffic on r-help could be reduced by creating a second list where
more elementary questions are asked.
There may be other ways to partition the universe of questions
2005 Mar 21
2
X11 Fonts sizes
In postscript graphs (pointsize = 10, different sizes in graph adjusted via
cex) I would like to use different font sizes but get the following warning
message:
Warning messages:
1: X11 used font size 8 when 9 was requested
2: X11 used font size 8 when 7 was requested
3: X11 used font size 8 when 5 was requested
This is probably not a R but a X11 problem, nevertheless I would be most
2010 Jul 09
2
Compress string memCompress/Decompress
Hello,
I would like to compress a long string (character vector), store the compressed string in the text field of a SQLite database (using RSQLite), and then load the text back into memory and decompress it back into the the original string. My character vector can be compressed considerably using standard gzip/bzip2 compression. In theory it should be much faster for me to compress/decompress
2012 Mar 02
3
subseting a data frame
HI,
this is my problem I want to subset this file df, using only unique
df$exon printing the line once even if df$exon appear several times:
unique(df$exon) will show me the unique exons
If I try to print only the unique exon lines
with df[unique(df$exon),] -this doesn't print only the unique ones :(
could you help?
thanks
Nat
exon size chr start
2009 Jul 28
2
Looking for example of usage of function unz
I would greatly appreciate some example of correct usage of function unz.
I have to download and uncompress the following web compressef file:
ftp://ftp.sanger.ac.uk/pub/mirbase/targets/v5/arch.v5.txt.homo_sapiens.zip
I tried the following command that does not work:
Targets.rec <- readLines(zz <- unz("ftp://ftp.sanger.ac.uk/pub/mirbase/targets/v5/arch.v5.txt.homo_sapiens.zip"))
2010 Apr 27
1
Cairo package failure to load backend
Hi R friends,
I've been attempting to create plots with multiple alpha values using
Cairo to save them on a windows (32b XP) platform as it doesn't support
more than 3 alpha values. This worked well until I wanted a postscript
file (unsupported) and as a attempted work around I installed RGtk2. So
far so good, however now when I try to use a
>CairoPDF("alpha.pdf", 6, 6,
2007 Nov 22
3
question about extreme value distribution
Hello,
I have a question about using extreme
value distribution in R.
I have two variables, X and Y, and have pairs
of points (X1,Y1),(X2,Y2), (X3,Y3) etc.
When I plot X against Y, it looks
like the maximum value of Y (for a particular X) is
correlated with X.
Indeed, when I bin the data by X-value into
equally sized bins, and test whether the maximum
value of Y for a bin is correlated with
2008 Oct 09
1
Reading zipped data directly from an FTP url
Hi
Sorry, I am clearly missing something here.
I want to read this file directly:
ftp://ftp.sanger.ac.uk/pub/mirbase/targets/v5/arch.v5.txt.gallus_gallus.
zip
I tried using
read.table(gzfile("ftp://ftp.sanger.ac.uk/pub/mirbase/targets/v5/arch.v5
.txt.gallus_gallus.zip"))
But I got an error:
Error in open.connection(file, "r") : cannot open the connection
In addition:
2011 Mar 14
1
Tinycore & error in memCompress() in make check
Hi,
I get the same error as mentioned in
http://r.789695.n4.nabble.com/error-in-memCompress-in-make-check-td3318922.html
I try to compile R 2.12.2 under Tinycore 3.5.1 running in VirtualBox 4.0.4.
Since first xz was not installed I must have used the internal version
which comes with the R source tar ball. But after installing the xz
5.0.0 extension the error remained. Any idea what else I
2008 Jul 08
2
attributing values to dataframe positions following eval
Hi everybody,
I've been looking around, but can't seem to find the answer.
I get a list of names (which vary, so I never know them in advance), and
transform them into variables, each of which is a dataframe, using
assign:
polyList <- c("rs123", "rs124", "rs555", "rs000")
numPoly <- length(polyList)
for (k in 1:numPoly) {
2004 May 27
2
Stats package
Hi
The cor function in the stats package calculates the correlation between
columns of data, does anyone know if it is at all possible to calculate
the correlation between rows instead ?
Or is there an appropriate package or function that is more appropriate
I'd like to calculate spearman & pearson correlations between rows.
Many thanks
Jason
--
--------------------------------
2009 Apr 23
1
Accessing all the first sub-elements of a list of list
Hello,
The 179th and 180th elements of my list of lists look like this:
[[179]]
[[179]]$desc
[1] ">ipi|IPI00646510|IPI00646510.2 ISOFORM P60-HCK OF TYROSINE-PROTEIN
KINASE HCK."
[[179]]$seq
[1]
"MGGRSSCEDPGCPRDEERAPRMGCMKSKFLQVGGNTFSKTETSASPHCPVYVPDPTSTIKPGPNSHNSNTP
GIREAGSEDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVDSLETEE
2005 Feb 18
9
Using time series and lm
Hello,
I apologize for this question that may has been asked a lot of times
but I could not go through it.
I create a multivariate time series containing NA values.
I want to compute a linear regression and obtain a time serie for both
residuals and fitted values. I have tried the trick ts.intersect,
without success.
Could you help me out of this?
####
Example:
y<-ts(1:10+rnorm(10))
2008 Aug 06
4
Font size in plots (I do NOT understand par help)
Hi,
I do not get how par works, help please.
Let's say I have a simple plot: plot(1:10)
I want to change the font size for the x axis... how do I do that?
Thank you,
Stephane
--
The Wellcome Trust Sanger Institute is operated by Genome Research
Limited, a charity registered in England with number 1021457 and a
compa
ny registered in England with number 2742969,
2005 Mar 29
2
Annotation metadata "kills" help.search
Greetings!
OS: Windows
R 2.0.1
Before anyone flames -- I tried to query this on the R searchable web site
and using google and did not find anything applicable.
As of about a week ago the help.search function dies when used in the simple
help.search("something") usage.
The error is
Error in rbind(...) : number of columns of matrices must match (see arg 203)
After some effort I have
2007 Dec 19
1
FW: cgh package
Hi,
I would like some extra information on the 'cgh' package in R. I noticed
that there isn't much activity regarding this package on the R and BioC
mailing list (I googled it).
I started using this package and I have few questions:
1/ As I have a custom tiling like array @8um features resolution (affy),
I have a lot of probes to work with. I'm assuming it is correct to
2009 Nov 17
1
strange read.table results
Hi I hope someone can shed some light on this:
For some reason when I
read.table("bfx.txt")
R decides to only give back the first character from each column in each row as one single column.
Like this:
V1
1 ÿþr
2 \n
3 r
4 1
5 0
6 A
7 G
8 \n
9 r
10 1
11 0
12 T
13 C
14 \n
The data should be:
2018 Jan 16
2
lost ability to apt-get install r-base=3.4.2-1trusty1
Hello,
I need a specific version of R installed for consistency reasons. I do the standard setup steps:
echo "deb https://cran.ma.imperial.ac.uk/bin/linux/ubuntu trusty/" | sudo tee -a /etc/apt/sources.list
sudo apt-key adv --keyserver keyserver.ubuntu.com --recv-keys E084DAB9
sudo apt-get update
And then a simple install call, which used to work just fine some time ago, tosses an
2008 Jun 29
2
How to get an argument dynamically from a list?
Hi,
I'd like to get an argument (I think it's the right term) dynamically from a list, but cannot manage to do it.
Here is the code I use:
#output given by database
BOB <- c('A/A', 'C/C', '15/27')
MARY <- c('A/A', NA, '13/12')
JOHN <- c('A/A', 'C/A', '154/35')
CLIFF <- c('A/C', 'C/C',
2010 Apr 06
1
lattice package: line end style
First, apologies for no example data but I don't think it's needed in
this case,
Q: Can (and if so how ) the line end style be changed for 'cloud' plots?
I've tried par(lend=2), trellis.par.set(add.line = list(lend=2)) and
much googling but to no avail
Thanks in advance
Dan
P.S. the reason for this is that the round end looks bad at lwd=3 or
more
Daniel Alcock
Malaria